Cla016178.1 (mRNA) Watermelon (97103) v1

NameCla016178
TypemRNA
OrganismCitrullus. lanatus (Watermelon (97103) v1)
DescriptionAP-2 complex subunit mu-1 (AHRD V1 **** O23140_ARATH); contains Interpro domain(s) IPR015629 Clathrin coat associated protein AP-50
LocationChr9 : 12382922 .. 12390537 (+)
Sequence length1317
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGCCGGTGGCTGCATCGGCCATTTACTTCCTCAATCTCCGAGGGGATGTTCTCATTAATCGTCTCTACCGCGACGATGTCGGGTAATTTTAGCTCTTTTTTTGTATCTTCTGAGTTTTCAATTATTATTCACGTAAAAGGGTTCGTGGCGTGCCGTTGTGCTTATATGATTGCTTTGGAGGATATATTATTAGTTTGGGGAGAGTCTGGATACGATTTTGTTTATTGGGTAGAGTCTACAATTTGGACGAGTTGATTAAACAATGCGAATTGTTGAGGTTTCTTGTAATTGAGCCTGAGCTGATTAACGGAATCATTTCTCAGTGAATTGTAGATTATGGGGTTTCCATGATAATCCCTTGATGTTATATATTTGGTGCTCAATCAGTGTTTTCAAGGTGCACTTAAGTACCTATGGCAAGGTGAAATGCAAGGTGCTTGCCTTTTTCACTTCTTAGTTGCGATGGGGCTACGAGCACTCGCCTTACTCATGAAGAAGAGGAAGAGTAGGAAGATTGATAAGAGAGGAAGAGAAGAAGTAGATAAACAAGGAGGGATGAGAAGAAAAATAAGAAGTTGAGTAGGAAGGAAAGAGAGAGAAAAACAAGAAAAAGAAAATGGTAAATTACCTTATGACGCAATGTAGGGAACCTTTCTACCCTTTGTGGATTATGTCATTTTTTGGTAGGGTTACCGTAGAGAAGCCCCTTTTAGACAAACTATTATGCAATCTGCATACATTATGTGATACGAATGGTGGTAAGCCAAAATGACTTTTTTAAGCTTCTAAAAGTGTGGTATGTAGTGATAGTTCCAAAAGGTGTTTGGTTATTCTATTGTCTCCGATATCTACAGGCAGCATATTATTGCATGGATGGAAGATTTCTTATTTCAGCTTATGGATGGAAGTTTTATGCAACTTTATGTTTTCTCGTTAAATTAAGCTGTTTAACTTTCTAAATCTAATGAATTCTCTTAGGGGAAACATGGTGGATGCCTTCCGAACACATATAATGCAGACAAAAGAACTTGGCACCTGTCCTGTGCGGCAGATTGGTGGTTGCTCTTTCTTTTACATGAGAATTAGCAATGTATACATTGTGATTGTTGTAAGCAGCAATGCAAATGTAGCTTGTGCATTCAAGTTTGTGGTTGAGGTAGTTAGCATCTTCTTTGTGGTTGTATACTTTGGTGGAATATTTTTTCCCTTCATGAGTTAAGTTTTGATGCTTGATTAATCAACTATTTGCGAGTTTATATATAGCTGCCTTATATAGTTAAACACCATTTTTTATGTAGCCAAATTTCTGTGGAATTAAGCTTAGCCAAGTAATAAAGGAAACATATTTTATTTTTATGGGACTTATGAGTGAGTTTTGCTTACAGGCTGTTGCACTGTTCAAATCTTATTTTGGTGGGGCTTTTGATGAAGATGCAATTCGAAACAATTTTGTTCTTATTTATGAGCTCTTGGATGGTATGTGATGCCTTGTTGGCAGTTTCTGTTCTTGTTTTCTTACTTTCTATGTATGTTCTTTTGGTTATGAGAGTAAGCATTGGAGAGATGAACATTGTTAATACTTAATAGTTTGATCGGCTCCAAGCAGAAAAAGATTAAAACAGTTATATTGCTGAATAAAATTTATTTTGTAAAAACTGTGTGCCGTAGGACTATAATTTTCTTGTTTAAAAATTACATAAAAATGAAAGGGAAAAAAAAAAAAATTCTACTAGCACAAGTAGAAATGGGCCACGTGCTGTGGACTGCTCTTTGTGCTATTGTTTAGGGTCTTTAGGGAGAAAAACAGTAGAATTTATAGAGGGGCCGAGAGATCTTCGGGCGTGGTGTGGTCCCTTATGAGATATCATGCTTCTTTTTTGGTTTTCGTTTGTAAAGAAATTACCCTTTAGATCTTATTTTGTTTGACTGGTTGCATCAGGTTAGCAATATGTTGTGTCAGCTATATGGGCTATATTCTGTGACTGAGTTGTTCAATTACTAGATTGTCTATGGACAATTTACTGGTTATATGCTCATGCATCTTTAAAAGCCAATCCTTCGTATGCTCCTCTGTGTTGATTCATTTTTCTTAATGAAAGCTTGGTTTTCTTTAAAAAGGAAAAAGAAAGATTCCAAGTTTTCTATTAGAGCTTCTGGTTGTGATAAATTGATTAGATCTATGATCTGTTTTATCTTACATATGTGTGTATATTTTTTACTAGAAGTTTATATATAAGCTTACAATTGGACATGCATGGCATAACTGTTGCTTTATAATTGTTGTTTCTGAAAACTAGAGGCACTTATGTAATGAAAATGAGGGAAAGGCTGATATCTGCCTTGCAATTGCAGAAATAATGGATTTTGGTTACCCACAAAACCTCTCTCCTGAAATTCTAAAACTATATATCACTCAGGAAGGAGTTCGCTCGCCATTCTCATCCAAGGTTAGATAATGTGTATATTTTTCAACAACCTGGGGGGATAAGCCAGATTTTGAGCCTGTTAAGGAGGCTTAACTATAACATTTCTGTACTGTACAATTTATTTCTACATCTCTCTCTCACCCTTTATAATTTGCTGGCCATTTGTATTTCTGAAGAGTATTTCATCCTCTTTTCTTCGCGAAGTTTCTCTAAATCAATAAAATTTTTGCTTGAAGTTAAAGTAAAAATATAGTTTTAAACAGGAATAAATGTTTGTTTATAAGTGATTTACTAACATCATTTTTTTCTGCACACTATGCCAAAAAAGCCTTCAGATAAACCTGTCCCAAATGCAACTTTACAAGTTACGGGTGCTGTTGGTTGGCGAAGGGAAGGCCTTGTATATAAAAAGAATGAGGTGAGTGACGATTCTTTCTCTTTTGTTTGCATGAATAAAGAACCTAACTAAATTGTGAACATTTTATTTATGCAGGTCTTTTTGGATATAGTTGAAAGTGTAAACCTTCTTATGTCTTCAAAAGGTAGTGAATACTTTCAAAGTTCCTTCTGTATCACATAGTTGATGTGGAAACTTATAAACTATTGTGTGATCATAGGTAGTGTTCTGCGTTGCGATGTAACTGGGAAGATTCTTATGAAGTGCTTTCTTTCTGGCATGCCTGATTTAAAGTTGGGTTTAAACGATAAGATTGGCCTTGAGAAAGAGTCACAGTTGAAGTCCCGTCCAGCTAAGAGGTAGTTTCTAATGGGCGACTTCAATGATACTCTACAGCCATACTATGTTCTATTGATTTATCTTGGCCATCCAAGGCTACCTTTTTTTTCCTTTTCACCATACCTAATTATTTATTTAGCATCGTTGACTCTTCTCTCTTTTCAACTGGATTTCTTTTGTCATACATGATTAATTTTATCTATGTGTTTGTATTGTGTGGCTATATGGAGTGCATCTTCCATAGCATCTTTTGGTTTCTTTTACTTTCGTAATATGAGGGGAAGACATAATTGTTTATAGTCTATTTTGTTTTTATTGTTGTGTTGTACCAAAAAATTCTGATCTGCTTGGTAAGTTCTTTTAAGAAGTTTTGAACAGATTTCTTGTGTTAGCATTGCCATTGCTTTTTGATGTTGATATTTGATTAATGTCAGTTTCATGTGCCTTACTGGCCAGTGTTATAATGAAGAAGTTAACAACATGGACTTATTAGATGCAGCTTAAAAAGTTTAGGTGGTAGACATATTAGTATTAGAAATCTTTTAAAGTTCCAACCTTGAAAGTTCAAGTGCCAAGCTTGTTGTTTAACCTTTAAATAGGATATCTCGTCAATATAATGTTTCTAATTCAGAATTATGATAATGCCCAGTACACATCACATGGATGCAGGGTTATTTTCTGAACTAGGATGGATATTAGTTTTTCATATGTTGGTGTAGCCTTTTATTTATTTTTAAGGAGGAACAAATGGTTTTTCTTTCTTTATGTTATATTTCTTCTTATTTTTTTCTTTTTTTCTTCTAGATTTAATGTTATGCATTTTCACGTGTCTTTGTGTATTAGTAAGTCAGCTTTGTGCTTTTTATTTAACTTTATGTGTATCATCAAGTTTTTCTCCACTCTTGCTTATTTTGCAATTAAAATCAGTTGTAGAAAACTTTCATGTTATACAGGTTGTCTTGTGCTATTTGCCCAAACTTATTTGAAAAAAAAAAAAAGGAAAAAGCAATTATTAGCAGTTGAGTAGTTCCACTTTTCTCATCTTTTCAATTTTGGCTGTGAAGAGTGACTTGGCTTAGACCGCTCTTACATGTTTACTGTATCTCAGAAGCAGTGTGGAATATCATAGGATTCAAGAATAGATTTTGGTTTCACATTTTTCTTTATTTTGTGATATTTCATTGGTCTGGTACAGTTACTGTAGTATAGAGTTAATGATCCAAGGTATGCATTTTTTTGTTTTATGATTTATTTTGCAGTGGTAAAACAATTGAGCTTGATGATGTTACTTTTCATCAATGTGTAAATTTGACGAGGTTTAACTCAGAGAAGACAGTCAGCTTTGTACCGCCGGATGGGGAATTTGAATTGATGAAGTAAGCTTGGATCTTTAATCTGTCTCGTGTGTTGTTTAAACTTATTACCAATATAGGATATACTATCTTCATTTTGATGAAATGTGGAGGTTTTCCTGAGGTATCTTCTTCTCCTGCAAGCAGAAAAAACCAACAAGTCCCAGAAAACAGGGGAATAGCAACCTCCCTGTCATATTTCAATTCCAAAATGAAAAACAGAGTTCCACAACAATGACAATAGTTCCAAAGAACAAGAACAGTAAGAAATAAAAATAAGAAACGATGAACAATCCAGCATATTCGAGAGAGCCGGAAATCCCATCCTAAGCCTCAGCTTTCTCCAAAACTTCCACACCTTATTCTCTTCCAAAAACCCCTACATAAACCCCACGGCTTGTCCTCGCACTACATAACAGAACTGTTGTCCCCTACCCATCTGTCAGCTTGTGCATTCCCCAATTTGCCCCTTCTTCCATAAGTATGGATAATTGGGGGTCTCACAGTTTTCCCCAGTAATGTTTATTGCGTTCCTATCAGCATGTCATGGACACAATTTTCTACTTTATGAAGCAAATTTGAGTGCTTTTGCACTTATCTAAGGTTGATTCAGTTTGTTATCAGTATTTGAGTATGAGAGTCATTAGTTGTACCCACACGGAACGTTTATTGTGCAACTTGTGAAAAAATTATCCATGTGATCCATCATCTCTTGTAGAGGGAAGGACAAAGGACCCCACCCTGTGCCTAGAAGGTAGAGAGAGGGAAAATGGATAATTTTCTGTTTGGAGGCACACTGAGAGTTTATTCCATTTTCATGCTTATTCTCTCATACGTGCAAGGTATTTCTTCTCCTATATCTGATATAATATCTTGATCTTCTTTTGAATCTTTAATGCAGATACCGTATTACTGAGGGTGTTAATCTTCCATTTCGAGTTCTCCCAACAATTAAGGAACTTGGTAGGACACATATGGAAGTTAATGTTAAGGTTTGTGGTTCTCTAATTTTTTATGATCTTGATGTACCAAGTTCTACAATTCTTTTTAAGTCCATTATCAACTGGCCTTCAGGTGAAGAGTGTCTTTGGTGCAAAAATGTTTGCTCTTGGCGTGGTCATTAAAATTCCTGTTCCAAAACAGACAGCTAAAACTAGTTTTCAAGTGACATCAGGTCGAGCCAAGTACAACGCCTCAATCGATTGCATTGTGTGGAAGTGAGTGTTTCCTGTAGTTTTAAAAATATGCTAATTGAGTGTCTGGTTTTTTCTTTGCACAAATACATGGTAATGAACATTGTGCATATATATTTGCGCGGTTGCATCTTTGTGATATCATATCATCTATAATTTTGTTCCATTCATTACAAATGTCTTCATGTTTTTGTCTTTAGTATGTTATGGCGTAATCTCTATTCTCACATAGATTTCTTGTTTTACTTATCACATGCTTGTGTGGTTGCTTTCTTTCTTTTCTAAATTATATATGTTTTACATGCATGCATTCTCTTATATTTGTGCAATGAGGTTGGATTTATGTGATTTCATTTCATATTATCTACAATTTTCTCAAATCTCGATAGATCTTAATTGATGCCTCAGAATTCCACCTCAAAATAAATTAAAAGATTTTGCAGTCTACACTATGATTTTACACTAGGAATTTCTTATCAGTGCTTCTCATGTTCTCACAGGAACTTAATTTTCTGCTGAATGAGTACATTATGTTCAGTCTCATGTTTATGGATTTATAGTTGTGGCTTAGAATTTTATTTGTGTCAATTTTAGGATCAGAAAATTTCCTGGACAAACAGAACCAACCATGAGTGCAGAAGTCGAGCTGATTTCTACAATGACCGAAAGGAAGCCTTGGACACGGCCACCAATTCAGATGGAGTTTCAGGTTGTCAAAGATTTAATTTTAGCATACTATTTTTGCCATGATGCATCAACGGATGTTCTTTCAACAGTAGCTTAAGCACGGGCTTTCTGCTCCCTGCTATGTAGGGTTGATTAAATGGTTTTTGTAGTGCTTTTTCTCCATCGTCATTTTATTGTGCAATAGTTTTTAGAACTTCTTTATAAGAACATTTCCATGGTCTGCTTTATAAGTGTTCATTGCCCAAACAGATTTTTATGTAGTTTTCTTTTGTTCCTGGTTAGGAAACAATTTTTTGTTAAAAAAAAAGGATCAAATGCAGTTACTTTTTTAAAATTTAGAAGCCAAAAGCAAAAAAGAAGCTTCTAAAATGTTCTCCTTATTAGTTTCATTAAGAAAAAGAAAGAGATTCTAAAATGTTGTCACAAGGACCGGTTTCCCATCTTCAAACTGGGAATAGATGTTCTGATGAATTAGGTCGTTAATTTCTTTCTTCTCTGGCTTATAATTATGTTGGTGGTAAAATATTTATACTTTTGGGTTTACAGGTTCCCATGTTCACAGCATCTGGTTTACGAGTCCGTTTCCTTAAGGTATTTGTTGTCTTTTCCTTCCTACTACTGCTTGGTAGCAGAGAAGTATGTGAACGATTCAGTTTATGGCATGATAATAGTTGGAAGAAAAGGAAAAAAAATGTCTCTTGTGAACGATGTAGATGATTAATTTCTGATTTGATAGAATTTACGTTAGTCTAAACGGTTGTATGGACTTCATTTTATTCTTTCATTAAAGTAAGTTAAAGTGGGAGGGTTCAAACAATAGACTGGCTTTCGATTGCAAATCTGAATATTTCTTGACCGCATGCTAGATGTAATTTATTAACATACGTTTTTGTGAAATTTGAAATAACTAGTGTTTATCATTATTAGAAAATTAGTTATGTGAGTGGGGTTTACGGATTTGTTTAAGGTTATAAGATATTTCTAAGACATGTCTGACCAAATTTTTGTTATTAGAAAATTCTCAAGTAATATGGATGGAGTTAAAGCATGTGCAGCTGTTGTGTTATAGTTTTAGAAATGAGAGTGCTAACTCTTTCCTGCTGGTCCAAAATGAAGCCTTTTTGTCAATTTGTTCTTCAGGTGTGGGAGAAAAGTGGTTACAACACCGTCGAATGGGTTCGTTACATAACTAAAGCTGGATCATATGAGATCCGGTGTTAG

mRNA sequence

ATGCCGGTGGCTGCATCGGCCATTTACTTCCTCAATCTCCGAGGGGATGTTCTCATTAATCGTCTCTACCGCGACGATGTCGGGGGAAACATGGTGGATGCCTTCCGAACACATATAATGCAGACAAAAGAACTTGGCACCTGTCCTGTGCGGCAGATTGGTGGTTGCTCTTTCTTTTACATGAGAATTAGCAATGTATACATTGTGATTGTTGTAAGCAGCAATGCAAATGTAGCTTGTGCATTCAAGTTTGTGGTTGAGGCTGTTGCACTGTTCAAATCTTATTTTGGTGGGGCTTTTGATGAAGATGCAATTCGAAACAATTTTGTTCTTATTTATGAGCTCTTGGATGAAATAATGGATTTTGGTTACCCACAAAACCTCTCTCCTGAAATTCTAAAACTATATATCACTCAGGAAGGAGTTCGCTCGCCATTCTCATCCAAGCCTTCAGATAAACCTGTCCCAAATGCAACTTTACAAGTTACGGGTGCTGTTGGTTGGCGAAGGGAAGGCCTTGTATATAAAAAGAATGAGGTCTTTTTGGATATAGTTGAAAGTGTAAACCTTCTTATGTCTTCAAAAGGTAGTGTTCTGCGTTGCGATGTAACTGGGAAGATTCTTATGAAGTGCTTTCTTTCTGGCATGCCTGATTTAAAGTTGGGTTTAAACGATAAGATTGGCCTTGAGAAAGAGTCACAGTTGAAGTCCCGTCCAGCTAAGAGTGGTAAAACAATTGAGCTTGATGATGTTACTTTTCATCAATGTGTAAATTTGACGAGGTTTAACTCAGAGAAGACAGTCAGCTTTGTACCGCCGGATGGGGAATTTGAATTGATGAAATACCGTATTACTGAGGGTGTTAATCTTCCATTTCGAGTTCTCCCAACAATTAAGGAACTTGGTAGGACACATATGGAAGTTAATGTTAAGGTGAAGAGTGTCTTTGGTGCAAAAATGTTTGCTCTTGGCGTGGTCATTAAAATTCCTGTTCCAAAACAGACAGCTAAAACTAGTTTTCAAGTGACATCAGGTCGAGCCAAGTACAACGCCTCAATCGATTGCATTGTGTGGAAGATCAGAAAATTTCCTGGACAAACAGAACCAACCATGAGTGCAGAAGTCGAGCTGATTTCTACAATGACCGAAAGGAAGCCTTGGACACGGCCACCAATTCAGATGGAGTTTCAGGTTCCCATGTTCACAGCATCTGGTTTACGAGTCCGTTTCCTTAAGGTGTGGGAGAAAAGTGGTTACAACACCGTCGAATGGGTTCGTTACATAACTAAAGCTGGATCATATGAGATCCGGTGTTAG

Coding sequence (CDS)

ATGCCGGTGGCTGCATCGGCCATTTACTTCCTCAATCTCCGAGGGGATGTTCTCATTAATCGTCTCTACCGCGACGATGTCGGGGGAAACATGGTGGATGCCTTCCGAACACATATAATGCAGACAAAAGAACTTGGCACCTGTCCTGTGCGGCAGATTGGTGGTTGCTCTTTCTTTTACATGAGAATTAGCAATGTATACATTGTGATTGTTGTAAGCAGCAATGCAAATGTAGCTTGTGCATTCAAGTTTGTGGTTGAGGCTGTTGCACTGTTCAAATCTTATTTTGGTGGGGCTTTTGATGAAGATGCAATTCGAAACAATTTTGTTCTTATTTATGAGCTCTTGGATGAAATAATGGATTTTGGTTACCCACAAAACCTCTCTCCTGAAATTCTAAAACTATATATCACTCAGGAAGGAGTTCGCTCGCCATTCTCATCCAAGCCTTCAGATAAACCTGTCCCAAATGCAACTTTACAAGTTACGGGTGCTGTTGGTTGGCGAAGGGAAGGCCTTGTATATAAAAAGAATGAGGTCTTTTTGGATATAGTTGAAAGTGTAAACCTTCTTATGTCTTCAAAAGGTAGTGTTCTGCGTTGCGATGTAACTGGGAAGATTCTTATGAAGTGCTTTCTTTCTGGCATGCCTGATTTAAAGTTGGGTTTAAACGATAAGATTGGCCTTGAGAAAGAGTCACAGTTGAAGTCCCGTCCAGCTAAGAGTGGTAAAACAATTGAGCTTGATGATGTTACTTTTCATCAATGTGTAAATTTGACGAGGTTTAACTCAGAGAAGACAGTCAGCTTTGTACCGCCGGATGGGGAATTTGAATTGATGAAATACCGTATTACTGAGGGTGTTAATCTTCCATTTCGAGTTCTCCCAACAATTAAGGAACTTGGTAGGACACATATGGAAGTTAATGTTAAGGTGAAGAGTGTCTTTGGTGCAAAAATGTTTGCTCTTGGCGTGGTCATTAAAATTCCTGTTCCAAAACAGACAGCTAAAACTAGTTTTCAAGTGACATCAGGTCGAGCCAAGTACAACGCCTCAATCGATTGCATTGTGTGGAAGATCAGAAAATTTCCTGGACAAACAGAACCAACCATGAGTGCAGAAGTCGAGCTGATTTCTACAATGACCGAAAGGAAGCCTTGGACACGGCCACCAATTCAGATGGAGTTTCAGGTTCCCATGTTCACAGCATCTGGTTTACGAGTCCGTTTCCTTAAGGTGTGGGAGAAAAGTGGTTACAACACCGTCGAATGGGTTCGTTACATAACTAAAGCTGGATCATATGAGATCCGGTGTTAG

Protein sequence

MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFYMRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQNLSPEILKLYITQEGVRSPFSSKPSDKPVPNATLQVTGAVGWRREGLVYKKNEVFLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPAKSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKELGRTHMEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCIVWKIRKFPGQTEPTMSAEVELISTMTERKPWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC
BLAST of Cla016178 vs. Swiss-Prot
Match: AP2M_ARATH (AP-2 complex subunit mu OS=Arabidopsis thaliana GN=AP2M PE=1 SV=1)

HSP 1 Score: 842.4 bits (2175), Expect = 2.2e-243
Identity = 416/438 (94.98%), Postives = 425/438 (97.03%), Query Frame = 1

Query: 1   MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY 60
           MPVAASAIYFLNLRGDVLINR YRDDVGGNMVDAFRTHIMQTKELG CPVRQIGGCSF Y
Sbjct: 1   MPVAASAIYFLNLRGDVLINRTYRDDVGGNMVDAFRTHIMQTKELGNCPVRQIGGCSFVY 60

Query: 61  MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM 120
           MRISNVYIVIVVSSNANVAC FKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct: 61  MRISNVYIVIVVSSNANVACGFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM 120

Query: 121 DFGYPQNLSPEILKLYITQEGVRSPFSSKPSDKPVPNATLQVTGAVGWRREGLVYKKNEV 180
           DFGYPQNLSPEILKLYITQEGVRSPFSSKP DKPVPNATLQVTGAVGWRREGL YKKNEV
Sbjct: 121 DFGYPQNLSPEILKLYITQEGVRSPFSSKPKDKPVPNATLQVTGAVGWRREGLAYKKNEV 180

Query: 181 FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA 240
           FLDIVESVNLLMSSKG+VLRCDVTGK+LMKCFLSGMPDLKLGLNDKIGLEKES++KSRPA
Sbjct: 181 FLDIVESVNLLMSSKGNVLRCDVTGKVLMKCFLSGMPDLKLGLNDKIGLEKESEMKSRPA 240

Query: 241 KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 300
           KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE
Sbjct: 241 KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 300

Query: 301 LGRTHMEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCIVWKI 360
           LGRT MEVNVKVKSVFGAKMFALGVV+KIPVPKQTAKT+FQVT+GRAKYN SIDC+VWKI
Sbjct: 301 LGRTRMEVNVKVKSVFGAKMFALGVVVKIPVPKQTAKTNFQVTTGRAKYNPSIDCLVWKI 360

Query: 361 RKFPGQTEPTMSAEVELISTMTERKPWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN 420
           RKFPGQTE T+SAE+ELISTM E+K WTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN
Sbjct: 361 RKFPGQTESTLSAEIELISTMGEKKSWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN 420

Query: 421 TVEWVRYITKAGSYEIRC 439
           TVEWVRYITKAGSYEIRC
Sbjct: 421 TVEWVRYITKAGSYEIRC 438

BLAST of Cla016178 vs. Swiss-Prot
Match: AP2M_DICDI (AP-2 complex subunit mu OS=Dictyostelium discoideum GN=apm2 PE=2 SV=2)

HSP 1 Score: 469.9 bits (1208), Expect = 3.0e-131
Identity = 228/438 (52.05%), Postives = 315/438 (71.92%), Query Frame = 1

Query: 6   SAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFYMRISN 65
           SA++ +N +G+VLI+R+YRDD+   + +AFR  ++ ++E  + PV+ IG  SF Y+++ N
Sbjct: 3   SALFLMNGKGEVLISRIYRDDISRGVANAFRLEVIGSQETRS-PVKLIGSTSFMYIKVGN 62

Query: 66  VYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYP 125
           +YIV V   N N    F+ + + V +FKSYF    DED+IRNNFVL+YELLDEI+DFGYP
Sbjct: 63  IYIVGVSRQNVNACMVFEVLHQLVDIFKSYFDN-LDEDSIRNNFVLVYELLDEILDFGYP 122

Query: 126 QNLSPEILKLYITQEGVRSPFSSKPSDKPVPNATLQVTGAVGWRREGLVYKKNEVFLDIV 185
           QN S ++LKLYITQ   +     K     +   T+Q TG   WR   + YK+NE+++D+V
Sbjct: 123 QNCSTDVLKLYITQGQGKLKSLDKLKQDKISKITIQATGTTPWRTPDIKYKRNELYIDVV 182

Query: 186 ESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKS-RPAKSGK 245
           ESVNLLMS++G++LR DV+G+++MKCFLSGMP+ K G+NDK+ +++E        A+SG 
Sbjct: 183 ESVNLLMSAEGNILRADVSGQVMMKCFLSGMPECKFGMNDKVIMDREKSTNGGSAARSGA 242

Query: 246 T----IELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 305
                IE+DD+TFHQCV L +F+S++TVSF+PPDGEFELM+YR TE +NLPF+V+P ++E
Sbjct: 243 RRANGIEIDDITFHQCVRLGKFDSDRTVSFIPPDGEFELMRYRTTEHINLPFKVIPIVRE 302

Query: 306 LGRTHMEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCIVWKI 365
           +GRT +E +V VKS F +KMF   V + IP PK TA     V +G+AKY    D I+W+I
Sbjct: 303 MGRTRLECSVTVKSNFSSKMFGANVKVIIPTPKNTAVCKIVVAAGKAKYMPEQDAIIWRI 362

Query: 366 RKFPGQTEPTMSAEVELISTMT-ERKPWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGY 425
           R+FPG TE T+ AEVEL++++  ++K W+RPPI MEFQV MFTASG  VRFLKV EKS Y
Sbjct: 363 RRFPGDTEFTLRAEVELMASVNLDKKAWSRPPISMEFQVTMFTASGFSVRFLKVVEKSNY 422

Query: 426 NTVEWVRYITKAGSYEIR 438
             ++WVRY+TKAG+Y+ R
Sbjct: 423 TPIKWVRYLTKAGTYQNR 438

BLAST of Cla016178 vs. Swiss-Prot
Match: AP2M1_MOUSE (AP-2 complex subunit mu OS=Mus musculus GN=Ap2m1 PE=1 SV=1)

HSP 1 Score: 428.3 bits (1100), Expect = 9.9e-119
Identity = 211/437 (48.28%), Postives = 302/437 (69.11%), Query Frame = 1

Query: 8   IYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFYMRISNVY 67
           ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SFF+++ SN++
Sbjct: 5   LFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIW 64

Query: 68  IVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQN 127
           +  V   N N A  F+F+ +   +  +YFG    E+ I+NNFVLIYELLDEI+DFGYPQN
Sbjct: 65  LAAVTKQNVNAAMVFEFLYKMCDVMAAYFG-KISEENIKNNFVLIYELLDEILDFGYPQN 124

Query: 128 LSPEILKLYITQEGVRSPFSSKPSDKPVPNATLQVTGAVGWRREGLVYKKNEVFLDIVES 187
                LK +ITQ+G++S   +K     +   T QVTG +GWRREG+ Y++NE+FLD++ES
Sbjct: 125 SETGALKTFITQQGIKSQHQTKEEQSQI---TSQVTGQIGWRREGIKYRRNELFLDVLES 184

Query: 188 VNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQ-LKSRPAKSGK-T 247
           VNLLMS +G VL   V+G+++MK +LSGMP+ K G+NDKI +EK+ +      +KSGK +
Sbjct: 185 VNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQS 244

Query: 248 IELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKELGRTH 307
           I +DD TFHQCV L++F+SE+++SF+PPDGEFELM+YR T+ + LPFRV+P ++E+GRT 
Sbjct: 245 IAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTK 304

Query: 308 MEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCIVWKIRKFPG 367
           +EV V +KS F   + A  + ++IP P  T+        G+AKY AS + IVWKI++  G
Sbjct: 305 LEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAG 364

Query: 368 QTEPTMSAEVELISTMTERKPWTRPPIQMEFQVPMFTASGLRVRFLKVWEK----SGYNT 427
             E  +SAE+EL+ T  ++K W RPPI M F+VP F  SGL+VR+LKV+E     S ++ 
Sbjct: 365 MKESQISAEIELLPT-NDKKKWARPPISMNFEVP-FAPSGLKVRYLKVFEPKLNYSDHDV 424

Query: 428 VEWVRYITKAGSYEIRC 439
           ++WVRYI ++G YE RC
Sbjct: 425 IKWVRYIGRSGIYETRC 435

BLAST of Cla016178 vs. Swiss-Prot
Match: AP2M1_MACFA (AP-2 complex subunit mu OS=Macaca fascicularis GN=AP2M1 PE=2 SV=1)

HSP 1 Score: 428.3 bits (1100), Expect = 9.9e-119
Identity = 211/437 (48.28%), Postives = 302/437 (69.11%), Query Frame = 1

Query: 8   IYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFYMRISNVY 67
           ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SFF+++ SN++
Sbjct: 5   LFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIW 64

Query: 68  IVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQN 127
           +  V   N N A  F+F+ +   +  +YFG    E+ I+NNFVLIYELLDEI+DFGYPQN
Sbjct: 65  LAAVTKQNVNAAMVFEFLYKMCDVMAAYFG-KISEENIKNNFVLIYELLDEILDFGYPQN 124

Query: 128 LSPEILKLYITQEGVRSPFSSKPSDKPVPNATLQVTGAVGWRREGLVYKKNEVFLDIVES 187
                LK +ITQ+G++S   +K     +   T QVTG +GWRREG+ Y++NE+FLD++ES
Sbjct: 125 SETGALKTFITQQGIKSQHQTKEEQSQI---TSQVTGQIGWRREGIKYRRNELFLDVLES 184

Query: 188 VNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQ-LKSRPAKSGK-T 247
           VNLLMS +G VL   V+G+++MK +LSGMP+ K G+NDKI +EK+ +      +KSGK +
Sbjct: 185 VNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQS 244

Query: 248 IELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKELGRTH 307
           I +DD TFHQCV L++F+SE+++SF+PPDGEFELM+YR T+ + LPFRV+P ++E+GRT 
Sbjct: 245 IAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTK 304

Query: 308 MEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCIVWKIRKFPG 367
           +EV V +KS F   + A  + ++IP P  T+        G+AKY AS + IVWKI++  G
Sbjct: 305 LEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAG 364

Query: 368 QTEPTMSAEVELISTMTERKPWTRPPIQMEFQVPMFTASGLRVRFLKVWEK----SGYNT 427
             E  +SAE+EL+ T  ++K W RPPI M F+VP F  SGL+VR+LKV+E     S ++ 
Sbjct: 365 MKESQISAEIELLPT-NDKKKWARPPISMNFEVP-FAPSGLKVRYLKVFEPKLNYSDHDV 424

Query: 428 VEWVRYITKAGSYEIRC 439
           ++WVRYI ++G YE RC
Sbjct: 425 IKWVRYIGRSGIYETRC 435

BLAST of Cla016178 vs. Swiss-Prot
Match: AP2M1_HUMAN (AP-2 complex subunit mu OS=Homo sapiens GN=AP2M1 PE=1 SV=2)

HSP 1 Score: 428.3 bits (1100), Expect = 9.9e-119
Identity = 211/437 (48.28%), Postives = 302/437 (69.11%), Query Frame = 1

Query: 8   IYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFYMRISNVY 67
           ++  N +G+VLI+R+YRDD+G N VDAFR +++  ++    PV  I   SFF+++ SN++
Sbjct: 5   LFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIW 64

Query: 68  IVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQN 127
           +  V   N N A  F+F+ +   +  +YFG    E+ I+NNFVLIYELLDEI+DFGYPQN
Sbjct: 65  LAAVTKQNVNAAMVFEFLYKMCDVMAAYFG-KISEENIKNNFVLIYELLDEILDFGYPQN 124

Query: 128 LSPEILKLYITQEGVRSPFSSKPSDKPVPNATLQVTGAVGWRREGLVYKKNEVFLDIVES 187
                LK +ITQ+G++S   +K     +   T QVTG +GWRREG+ Y++NE+FLD++ES
Sbjct: 125 SETGALKTFITQQGIKSQHQTKEEQSQI---TSQVTGQIGWRREGIKYRRNELFLDVLES 184

Query: 188 VNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQ-LKSRPAKSGK-T 247
           VNLLMS +G VL   V+G+++MK +LSGMP+ K G+NDKI +EK+ +      +KSGK +
Sbjct: 185 VNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQS 244

Query: 248 IELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKELGRTH 307
           I +DD TFHQCV L++F+SE+++SF+PPDGEFELM+YR T+ + LPFRV+P ++E+GRT 
Sbjct: 245 IAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTK 304

Query: 308 MEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCIVWKIRKFPG 367
           +EV V +KS F   + A  + ++IP P  T+        G+AKY AS + IVWKI++  G
Sbjct: 305 LEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAG 364

Query: 368 QTEPTMSAEVELISTMTERKPWTRPPIQMEFQVPMFTASGLRVRFLKVWEK----SGYNT 427
             E  +SAE+EL+ T  ++K W RPPI M F+VP F  SGL+VR+LKV+E     S ++ 
Sbjct: 365 MKESQISAEIELLPT-NDKKKWARPPISMNFEVP-FAPSGLKVRYLKVFEPKLNYSDHDV 424

Query: 428 VEWVRYITKAGSYEIRC 439
           ++WVRYI ++G YE RC
Sbjct: 425 IKWVRYIGRSGIYETRC 435

BLAST of Cla016178 vs. TrEMBL
Match: A0A0A0LI53_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G902930 PE=3 SV=1)

HSP 1 Score: 877.1 bits (2265), Expect = 9.0e-252
Identity = 438/438 (100.00%), Postives = 438/438 (100.00%), Query Frame = 1

Query: 1   MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY 60
           MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY
Sbjct: 1   MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY 60

Query: 61  MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM 120
           MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct: 61  MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM 120

Query: 121 DFGYPQNLSPEILKLYITQEGVRSPFSSKPSDKPVPNATLQVTGAVGWRREGLVYKKNEV 180
           DFGYPQNLSPEILKLYITQEGVRSPFSSKPSDKPVPNATLQVTGAVGWRREGLVYKKNEV
Sbjct: 121 DFGYPQNLSPEILKLYITQEGVRSPFSSKPSDKPVPNATLQVTGAVGWRREGLVYKKNEV 180

Query: 181 FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA 240
           FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA
Sbjct: 181 FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA 240

Query: 241 KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 300
           KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE
Sbjct: 241 KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 300

Query: 301 LGRTHMEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCIVWKI 360
           LGRTHMEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCIVWKI
Sbjct: 301 LGRTHMEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCIVWKI 360

Query: 361 RKFPGQTEPTMSAEVELISTMTERKPWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN 420
           RKFPGQTEPTMSAEVELISTMTERKPWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN
Sbjct: 361 RKFPGQTEPTMSAEVELISTMTERKPWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN 420

Query: 421 TVEWVRYITKAGSYEIRC 439
           TVEWVRYITKAGSYEIRC
Sbjct: 421 TVEWVRYITKAGSYEIRC 438

BLAST of Cla016178 vs. TrEMBL
Match: A9PDI1_POPTR (AP47/50p mRNA family protein OS=Populus trichocarpa GN=POPTR_0003s08940g PE=2 SV=1)

HSP 1 Score: 863.6 bits (2230), Expect = 1.0e-247
Identity = 429/438 (97.95%), Postives = 435/438 (99.32%), Query Frame = 1

Query: 1   MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY 60
           MPVAASA+YFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY
Sbjct: 1   MPVAASAVYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY 60

Query: 61  MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM 120
           MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct: 61  MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM 120

Query: 121 DFGYPQNLSPEILKLYITQEGVRSPFSSKPSDKPVPNATLQVTGAVGWRREGLVYKKNEV 180
           DFGYPQNLSPEILKLYITQEGVRSPFSSKP+DKPVPNATLQVTGAVGWRREGLVYKKNEV
Sbjct: 121 DFGYPQNLSPEILKLYITQEGVRSPFSSKPTDKPVPNATLQVTGAVGWRREGLVYKKNEV 180

Query: 181 FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA 240
           FLDIVESVNLLMSSKG+VLRCDVTGK+LMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA
Sbjct: 181 FLDIVESVNLLMSSKGNVLRCDVTGKVLMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA 240

Query: 241 KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 300
           KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE
Sbjct: 241 KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 300

Query: 301 LGRTHMEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCIVWKI 360
           LGRT MEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNA+IDCIVWKI
Sbjct: 301 LGRTRMEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNAAIDCIVWKI 360

Query: 361 RKFPGQTEPTMSAEVELISTMTERKPWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN 420
           RKFPGQTEPTMSAEVELISTM E+K WTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN
Sbjct: 361 RKFPGQTEPTMSAEVELISTMAEKKSWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN 420

Query: 421 TVEWVRYITKAGSYEIRC 439
           TVEWVRYITKAGSYEIRC
Sbjct: 421 TVEWVRYITKAGSYEIRC 438

BLAST of Cla016178 vs. TrEMBL
Match: A0A067KDR8_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_13593 PE=3 SV=1)

HSP 1 Score: 863.2 bits (2229), Expect = 1.3e-247
Identity = 430/438 (98.17%), Postives = 435/438 (99.32%), Query Frame = 1

Query: 1   MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY 60
           MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSFFY
Sbjct: 1   MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY 60

Query: 61  MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM 120
           MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct: 61  MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM 120

Query: 121 DFGYPQNLSPEILKLYITQEGVRSPFSSKPSDKPVPNATLQVTGAVGWRREGLVYKKNEV 180
           DFGYPQNLSPEILKLYITQEGVRSPFSSKP+DKPVPNATLQVTGAVGWRREGLVYKKNEV
Sbjct: 121 DFGYPQNLSPEILKLYITQEGVRSPFSSKPTDKPVPNATLQVTGAVGWRREGLVYKKNEV 180

Query: 181 FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA 240
           FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA
Sbjct: 181 FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA 240

Query: 241 KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 300
           KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE
Sbjct: 241 KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 300

Query: 301 LGRTHMEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCIVWKI 360
           LGRT MEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNA+IDC+VWKI
Sbjct: 301 LGRTRMEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNAAIDCLVWKI 360

Query: 361 RKFPGQTEPTMSAEVELISTMTERKPWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN 420
           RKFPGQTEPT+SAEVELISTMTE+K WTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN
Sbjct: 361 RKFPGQTEPTLSAEVELISTMTEKKSWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN 420

Query: 421 TVEWVRYITKAGSYEIRC 439
           TVEWVRYITKAGSYEIRC
Sbjct: 421 TVEWVRYITKAGSYEIRC 438

BLAST of Cla016178 vs. TrEMBL
Match: A0A067EB58_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g013671mg PE=3 SV=1)

HSP 1 Score: 862.8 bits (2228), Expect = 1.8e-247
Identity = 429/438 (97.95%), Postives = 434/438 (99.09%), Query Frame = 1

Query: 1   MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY 60
           MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY
Sbjct: 1   MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY 60

Query: 61  MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM 120
           MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct: 61  MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM 120

Query: 121 DFGYPQNLSPEILKLYITQEGVRSPFSSKPSDKPVPNATLQVTGAVGWRREGLVYKKNEV 180
           DFGYPQNLSPEILKLYITQEGVRSPFSSKP+D+PVPNATLQVTGAVGWRREGLVYKKNEV
Sbjct: 121 DFGYPQNLSPEILKLYITQEGVRSPFSSKPTDRPVPNATLQVTGAVGWRREGLVYKKNEV 180

Query: 181 FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA 240
           FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRP 
Sbjct: 181 FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPT 240

Query: 241 KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 300
           KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE
Sbjct: 241 KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 300

Query: 301 LGRTHMEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCIVWKI 360
           LGRT MEVNVK+KSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDC+VWKI
Sbjct: 301 LGRTRMEVNVKIKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCLVWKI 360

Query: 361 RKFPGQTEPTMSAEVELISTMTERKPWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN 420
           RKFPGQTEPTMSAEVELISTM E+K WTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN
Sbjct: 361 RKFPGQTEPTMSAEVELISTMAEKKSWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN 420

Query: 421 TVEWVRYITKAGSYEIRC 439
           TVEWVRYITKAGSYEIRC
Sbjct: 421 TVEWVRYITKAGSYEIRC 438

BLAST of Cla016178 vs. TrEMBL
Match: V4TEC0_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10031568mg PE=3 SV=1)

HSP 1 Score: 862.8 bits (2228), Expect = 1.8e-247
Identity = 429/438 (97.95%), Postives = 434/438 (99.09%), Query Frame = 1

Query: 1   MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY 60
           MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY
Sbjct: 1   MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY 60

Query: 61  MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM 120
           MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct: 61  MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM 120

Query: 121 DFGYPQNLSPEILKLYITQEGVRSPFSSKPSDKPVPNATLQVTGAVGWRREGLVYKKNEV 180
           DFGYPQNLSPEILKLYITQEGVRSPFSSKP+D+PVPNATLQVTGAVGWRREGLVYKKNEV
Sbjct: 121 DFGYPQNLSPEILKLYITQEGVRSPFSSKPTDRPVPNATLQVTGAVGWRREGLVYKKNEV 180

Query: 181 FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA 240
           FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRP 
Sbjct: 181 FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPT 240

Query: 241 KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 300
           KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE
Sbjct: 241 KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 300

Query: 301 LGRTHMEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCIVWKI 360
           LGRT MEVNVK+KSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDC+VWKI
Sbjct: 301 LGRTRMEVNVKIKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCLVWKI 360

Query: 361 RKFPGQTEPTMSAEVELISTMTERKPWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN 420
           RKFPGQTEPTMSAEVELISTM E+K WTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN
Sbjct: 361 RKFPGQTEPTMSAEVELISTMAEKKSWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN 420

Query: 421 TVEWVRYITKAGSYEIRC 439
           TVEWVRYITKAGSYEIRC
Sbjct: 421 TVEWVRYITKAGSYEIRC 438

BLAST of Cla016178 vs. NCBI nr
Match: gi|449461513|ref|XP_004148486.1| (PREDICTED: AP-2 complex subunit mu [Cucumis sativus])

HSP 1 Score: 877.1 bits (2265), Expect = 1.3e-251
Identity = 438/438 (100.00%), Postives = 438/438 (100.00%), Query Frame = 1

Query: 1   MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY 60
           MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY
Sbjct: 1   MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY 60

Query: 61  MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM 120
           MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct: 61  MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM 120

Query: 121 DFGYPQNLSPEILKLYITQEGVRSPFSSKPSDKPVPNATLQVTGAVGWRREGLVYKKNEV 180
           DFGYPQNLSPEILKLYITQEGVRSPFSSKPSDKPVPNATLQVTGAVGWRREGLVYKKNEV
Sbjct: 121 DFGYPQNLSPEILKLYITQEGVRSPFSSKPSDKPVPNATLQVTGAVGWRREGLVYKKNEV 180

Query: 181 FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA 240
           FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA
Sbjct: 181 FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA 240

Query: 241 KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 300
           KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE
Sbjct: 241 KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 300

Query: 301 LGRTHMEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCIVWKI 360
           LGRTHMEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCIVWKI
Sbjct: 301 LGRTHMEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCIVWKI 360

Query: 361 RKFPGQTEPTMSAEVELISTMTERKPWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN 420
           RKFPGQTEPTMSAEVELISTMTERKPWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN
Sbjct: 361 RKFPGQTEPTMSAEVELISTMTERKPWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN 420

Query: 421 TVEWVRYITKAGSYEIRC 439
           TVEWVRYITKAGSYEIRC
Sbjct: 421 TVEWVRYITKAGSYEIRC 438

BLAST of Cla016178 vs. NCBI nr
Match: gi|566161682|ref|XP_006385641.1| (AP47/50p mRNA family protein [Populus trichocarpa])

HSP 1 Score: 863.6 bits (2230), Expect = 1.5e-247
Identity = 429/438 (97.95%), Postives = 435/438 (99.32%), Query Frame = 1

Query: 1   MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY 60
           MPVAASA+YFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY
Sbjct: 1   MPVAASAVYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY 60

Query: 61  MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM 120
           MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct: 61  MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM 120

Query: 121 DFGYPQNLSPEILKLYITQEGVRSPFSSKPSDKPVPNATLQVTGAVGWRREGLVYKKNEV 180
           DFGYPQNLSPEILKLYITQEGVRSPFSSKP+DKPVPNATLQVTGAVGWRREGLVYKKNEV
Sbjct: 121 DFGYPQNLSPEILKLYITQEGVRSPFSSKPTDKPVPNATLQVTGAVGWRREGLVYKKNEV 180

Query: 181 FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA 240
           FLDIVESVNLLMSSKG+VLRCDVTGK+LMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA
Sbjct: 181 FLDIVESVNLLMSSKGNVLRCDVTGKVLMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA 240

Query: 241 KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 300
           KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE
Sbjct: 241 KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 300

Query: 301 LGRTHMEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCIVWKI 360
           LGRT MEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNA+IDCIVWKI
Sbjct: 301 LGRTRMEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNAAIDCIVWKI 360

Query: 361 RKFPGQTEPTMSAEVELISTMTERKPWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN 420
           RKFPGQTEPTMSAEVELISTM E+K WTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN
Sbjct: 361 RKFPGQTEPTMSAEVELISTMAEKKSWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN 420

Query: 421 TVEWVRYITKAGSYEIRC 439
           TVEWVRYITKAGSYEIRC
Sbjct: 421 TVEWVRYITKAGSYEIRC 438

BLAST of Cla016178 vs. NCBI nr
Match: gi|802634100|ref|XP_012077834.1| (PREDICTED: AP-2 complex subunit mu [Jatropha curcas])

HSP 1 Score: 863.2 bits (2229), Expect = 1.9e-247
Identity = 430/438 (98.17%), Postives = 435/438 (99.32%), Query Frame = 1

Query: 1   MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY 60
           MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFR HIMQTKELGTCPVRQIGGCSFFY
Sbjct: 1   MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRMHIMQTKELGTCPVRQIGGCSFFY 60

Query: 61  MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM 120
           MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct: 61  MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM 120

Query: 121 DFGYPQNLSPEILKLYITQEGVRSPFSSKPSDKPVPNATLQVTGAVGWRREGLVYKKNEV 180
           DFGYPQNLSPEILKLYITQEGVRSPFSSKP+DKPVPNATLQVTGAVGWRREGLVYKKNEV
Sbjct: 121 DFGYPQNLSPEILKLYITQEGVRSPFSSKPTDKPVPNATLQVTGAVGWRREGLVYKKNEV 180

Query: 181 FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA 240
           FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA
Sbjct: 181 FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA 240

Query: 241 KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 300
           KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE
Sbjct: 241 KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 300

Query: 301 LGRTHMEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCIVWKI 360
           LGRT MEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNA+IDC+VWKI
Sbjct: 301 LGRTRMEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNAAIDCLVWKI 360

Query: 361 RKFPGQTEPTMSAEVELISTMTERKPWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN 420
           RKFPGQTEPT+SAEVELISTMTE+K WTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN
Sbjct: 361 RKFPGQTEPTLSAEVELISTMTEKKSWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN 420

Query: 421 TVEWVRYITKAGSYEIRC 439
           TVEWVRYITKAGSYEIRC
Sbjct: 421 TVEWVRYITKAGSYEIRC 438

BLAST of Cla016178 vs. NCBI nr
Match: gi|567888406|ref|XP_006436725.1| (hypothetical protein CICLE_v10031568mg [Citrus clementina])

HSP 1 Score: 862.8 bits (2228), Expect = 2.5e-247
Identity = 429/438 (97.95%), Postives = 434/438 (99.09%), Query Frame = 1

Query: 1   MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY 60
           MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY
Sbjct: 1   MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY 60

Query: 61  MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM 120
           MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct: 61  MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM 120

Query: 121 DFGYPQNLSPEILKLYITQEGVRSPFSSKPSDKPVPNATLQVTGAVGWRREGLVYKKNEV 180
           DFGYPQNLSPEILKLYITQEGVRSPFSSKP+D+PVPNATLQVTGAVGWRREGLVYKKNEV
Sbjct: 121 DFGYPQNLSPEILKLYITQEGVRSPFSSKPTDRPVPNATLQVTGAVGWRREGLVYKKNEV 180

Query: 181 FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA 240
           FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRP 
Sbjct: 181 FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPT 240

Query: 241 KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 300
           KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE
Sbjct: 241 KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 300

Query: 301 LGRTHMEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCIVWKI 360
           LGRT MEVNVK+KSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDC+VWKI
Sbjct: 301 LGRTRMEVNVKIKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCLVWKI 360

Query: 361 RKFPGQTEPTMSAEVELISTMTERKPWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN 420
           RKFPGQTEPTMSAEVELISTM E+K WTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN
Sbjct: 361 RKFPGQTEPTMSAEVELISTMAEKKSWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN 420

Query: 421 TVEWVRYITKAGSYEIRC 439
           TVEWVRYITKAGSYEIRC
Sbjct: 421 TVEWVRYITKAGSYEIRC 438

BLAST of Cla016178 vs. NCBI nr
Match: gi|1009170060|ref|XP_015866002.1| (PREDICTED: AP-2 complex subunit mu [Ziziphus jujuba])

HSP 1 Score: 862.8 bits (2228), Expect = 2.5e-247
Identity = 430/438 (98.17%), Postives = 434/438 (99.09%), Query Frame = 1

Query: 1   MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY 60
           MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY
Sbjct: 1   MPVAASAIYFLNLRGDVLINRLYRDDVGGNMVDAFRTHIMQTKELGTCPVRQIGGCSFFY 60

Query: 61  MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM 120
           MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM
Sbjct: 61  MRISNVYIVIVVSSNANVACAFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIM 120

Query: 121 DFGYPQNLSPEILKLYITQEGVRSPFSSKPSDKPVPNATLQVTGAVGWRREGLVYKKNEV 180
           DFGYPQNLSPEILKLYITQEGVRSPFSSKP+DKPVPNATLQVTGAVGWRREGLVYKKNEV
Sbjct: 121 DFGYPQNLSPEILKLYITQEGVRSPFSSKPADKPVPNATLQVTGAVGWRREGLVYKKNEV 180

Query: 181 FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKSRPA 240
           FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLK+RP 
Sbjct: 181 FLDIVESVNLLMSSKGSVLRCDVTGKILMKCFLSGMPDLKLGLNDKIGLEKESQLKARPT 240

Query: 241 KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 300
           KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE
Sbjct: 241 KSGKTIELDDVTFHQCVNLTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKE 300

Query: 301 LGRTHMEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCIVWKI 360
           LGRT MEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDC+VWKI
Sbjct: 301 LGRTRMEVNVKVKSVFGAKMFALGVVIKIPVPKQTAKTSFQVTSGRAKYNASIDCLVWKI 360

Query: 361 RKFPGQTEPTMSAEVELISTMTERKPWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN 420
           RKFPGQTEPTMSAEVELISTM E+K WTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN
Sbjct: 361 RKFPGQTEPTMSAEVELISTMQEKKSWTRPPIQMEFQVPMFTASGLRVRFLKVWEKSGYN 420

Query: 421 TVEWVRYITKAGSYEIRC 439
           TVEWVRYITKAGSYEIRC
Sbjct: 421 TVEWVRYITKAGSYEIRC 438

The following BLAST results are available for this feature:
Match NameE-valueIdentityDescription
AP2M_ARATH2.2e-24394.98AP-2 complex subunit mu OS=Arabidopsis thaliana GN=AP2M PE=1 SV=1[more]
AP2M_DICDI3.0e-13152.05AP-2 complex subunit mu OS=Dictyostelium discoideum GN=apm2 PE=2 SV=2[more]
AP2M1_MOUSE9.9e-11948.28AP-2 complex subunit mu OS=Mus musculus GN=Ap2m1 PE=1 SV=1[more]
AP2M1_MACFA9.9e-11948.28AP-2 complex subunit mu OS=Macaca fascicularis GN=AP2M1 PE=2 SV=1[more]
AP2M1_HUMAN9.9e-11948.28AP-2 complex subunit mu OS=Homo sapiens GN=AP2M1 PE=1 SV=2[more]
Match NameE-valueIdentityDescription
A0A0A0LI53_CUCSA9.0e-252100.00Uncharacterized protein OS=Cucumis sativus GN=Csa_3G902930 PE=3 SV=1[more]
A9PDI1_POPTR1.0e-24797.95AP47/50p mRNA family protein OS=Populus trichocarpa GN=POPTR_0003s08940g PE=2 SV... [more]
A0A067KDR8_JATCU1.3e-24798.17Uncharacterized protein OS=Jatropha curcas GN=JCGZ_13593 PE=3 SV=1[more]
A0A067EB58_CITSI1.8e-24797.95Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g013671mg PE=3 SV=1[more]
V4TEC0_9ROSI1.8e-24797.95Uncharacterized protein OS=Citrus clementina GN=CICLE_v10031568mg PE=3 SV=1[more]
Match NameE-valueIdentityDescription
gi|449461513|ref|XP_004148486.1|1.3e-251100.00PREDICTED: AP-2 complex subunit mu [Cucumis sativus][more]
gi|566161682|ref|XP_006385641.1|1.5e-24797.95AP47/50p mRNA family protein [Populus trichocarpa][more]
gi|802634100|ref|XP_012077834.1|1.9e-24798.17PREDICTED: AP-2 complex subunit mu [Jatropha curcas][more]
gi|567888406|ref|XP_006436725.1|2.5e-24797.95hypothetical protein CICLE_v10031568mg [Citrus clementina][more]
gi|1009170060|ref|XP_015866002.1|2.5e-24798.17PREDICTED: AP-2 complex subunit mu [Ziziphus jujuba][more]
The following terms have been associated with this mRNA:
Vocabulary: INTERPRO
TermDefinition
IPR001392Clathrin_mu
IPR011012Longin-like_dom_sf
IPR018240Clathrin_mu_CS
Vocabulary: Biological Process
TermDefinition
GO:0006886intracellular protein transport
GO:0016192vesicle-mediated transport
GO:0006810transport
Vocabulary: Cellular Component
TermDefinition
GO:0030131clathrin adaptor complex
GO Assignments
This mRNA is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006886 intracellular protein transport
biological_process GO:0006810 transport
biological_process GO:0016192 vesicle-mediated transport
biological_process GO:0009058 biosynthetic process
biological_process GO:0006897 endocytosis
cellular_component GO:0030131 clathrin adaptor complex
cellular_component GO:0005829 cytosol
cellular_component GO:0005886 plasma membrane
molecular_function GO:0003824 catalytic activity
molecular_function GO:0030170 pyridoxal phosphate binding

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameType
Cla016178Cla016178gene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameType
Cla016178Cla016178.1-proteinpolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameType
Cla016178.1.cds1Cla016178.1.cds1CDS
Cla016178.1.cds2Cla016178.1.cds2CDS
Cla016178.1.cds3Cla016178.1.cds3CDS
Cla016178.1.cds4Cla016178.1.cds4CDS
Cla016178.1.cds5Cla016178.1.cds5CDS
Cla016178.1.cds6Cla016178.1.cds6CDS
Cla016178.1.cds7Cla016178.1.cds7CDS
Cla016178.1.cds8Cla016178.1.cds8CDS
Cla016178.1.cds9Cla016178.1.cds9CDS
Cla016178.1.cds10Cla016178.1.cds10CDS
Cla016178.1.cds11Cla016178.1.cds11CDS
Cla016178.1.cds12Cla016178.1.cds12CDS
Cla016178.1.cds13Cla016178.1.cds13CDS


Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001392Clathrin adaptor, mu subunitPRINTSPR00314CLATHRINADPTcoord: 357..368
score: 1.4E-62coord: 317..332
score: 1.4E-62coord: 248..275
score: 1.4E-62coord: 168..196
score: 1.4E-62coord: 102..129
score: 1.4E-62coord: 15..35
score: 1.4
IPR001392Clathrin adaptor, mu subunitPIRPIRSF005992AP_complex_mucoord: 4..438
score: 5.4E
IPR011012Longin-like domainunknownSSF64356SNARE-likecoord: 6..142
score: 3.36
IPR018240Clathrin adaptor, mu subunit, conserved sitePROSITEPS00990CLAT_ADAPTOR_M_1coord: 166..186
scor
NoneNo IPR availableGENE3DG3DSA:2.60.40.1170coord: 167..333
score: 3.2
NoneNo IPR availableGENE3DG3DSA:3.30.450.60coord: 5..142
score: 1.2
NoneNo IPR availablePANTHERPTHR10529LOW-DENSITY LIPOPROTEIN RECEPTOR-RELATEDcoord: 1..438
score:
NoneNo IPR availablePANTHERPTHR10529:SF224SUBFAMILY NOT NAMEDcoord: 1..438
score: