Cla003129.1 (mRNA) Watermelon (97103) v1

NameCla003129
TypemRNA
OrganismCitrullus. lanatus (Watermelon (97103) v1)
DescriptionTubulin alpha-2 chain (AHRD V1 ***- B9GY70_POPTR); contains Interpro domain(s) IPR002452 Alpha tubulin
LocationChr2 : 34223979 .. 34226553 (-)
Sequence length1350
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGAGGGAGATCATAAGCATCCACATTGGACAGGCTGGGATTCAGGTCGGCAATTCTTGCTGGGAGCTCTATTGCCTCGAACATGGCATTCAGCCCGATGGTATGATGCCCAGGTAATGCTTTTTTTCCTTCTTCATCTCTCTACCATTCTGCATTTCAATTCTCCTCCCTTTTTTGCTTCCTACCTTCTCTGGTCTCTCTCGATTTAAACTTTGTGTTTTCGTCTTTGATTATCACATTTGGATGTTCATCTGAAGCTGGGCTACACGATCCGAGTCTAATTTCTCATTGGGACTGTTGGAGTTGATTCTTTATTACAATTTTTATAGCACTGAGGACATTTTCCAATAAATTCCATATCTCGTATCTGACTGCATTTTGAATTTTGATGCGGAAGATTTATATGTGCATTTTTGTCAGGTTGATTACCTATTAAATGGAAGCTTCTGTTTTCTTTTTCCAGTGATACCTCCGAAGGTGTAGCACACGACGCTTTTAATCCGTTTTTTAGCGAGACCGGTTCAGGCAAGCATGTGCCTCGGGCTATATTTGTTGATTTAGAACCAACGGTGATTGATGAAGTTAGAACTGGAGCCTACCGGCAGCTCTTTCATCCGGAGCAATTGATATCTGGAAAAGAAGATGCTGCTAATAATTTTGCCCGCGGACACTACACAGGTGACGGATGTTGCTTTGTGGATGCTTAGTTGACATTTCATTTTACGTCACTCTGTTTGACGTATCTTTTATTTTATAGTTGGAAAGGAAATTGTAGATCTCTGTCTTGACCGGGTCAGGAAGTTGGCTGATAACTGCACCGGGTTACAAGGGTTTCTAGTCTTTAATGCTGTTGGTGGTGGCACTGGTTCTGGTTTGGGTTCGTTGTTGTTAGAGCGCTTGTCAGTGGATTATGGGAAGAAATCAAAGCTTGGTTTCACCATCTACCCATCTCCTCAGGTACTGATAATTCAAATGTAGATTAATCAAAACATTTGATCATTAAGAGGAAGAATCACTCAAATGGTAATACTGGGATAATTAGGAAATTGTTGCTTGTCTGAACAATATTGGACTTTGATCAGGTTTCAACTGCTGTCGTGGAGCCTTACAACAGCGTTCTTTCTACTCATTCTCTTCTTGAGCATACGGATGTTGCTGTTCTTCTAGACAATGAAGCTATATACGACATTTGTAGGAGATCTCTTGATATCGATAGGCCTACATATACCAACTTGAATAGATTGATATCTCAAATTATTTCATCCTTAACCACTTCATTGAGATTTGATGGAGCCATCAACGTGGACATAACCGAGTTCCAGACGAACCTTGTACCATATCCTCGCATTCATTTCATGCTCTCCTCATATGCTCCGGTTATCTCAGCAGAGAAGGCTTACCACGAACAGCTATCTGTACCTGAGATCACAAATGCAGTTTTTGAGCCTTCAAGCATGATGGCAAAATGTGATCCTAGGCATGGGAAATACATGGCTTGTTGCTTAATGTACCGAGGAGATGTTGTACCCAAAGATGTCAATGCTGCTGTTGCTACCATTAAGACGAAGCGGACCGTGCAGTTTGTTGACTGGTAAGTGGAAGAAATATAACTTGTTTATTTTGATGAAGTTTTAAAGCTTAGGAAAATTAGGACCTACTCTCAGTTTCCACGGGGATTGTTTTTGGTAGTTTGTTTCATATAGTAGCTTTTAAGAACTAATTTGTAGAGTAATGAAGGTGACTTGTAAACATTTCCATTATTATAGATCAGGAATATCGAGATTACTATGTGCCTGAAATAATCATTCACAAGCTTGTAGTGAAGGAAGAACAATTTAGTTGTTCTGCAAGTAAAAAATAATGAAAAAGAGAGAGACCCATGAGAACTCAGGGGAAAACAACCCTTAGAAAAGACAATATAACTGCAGAAGATGACGAAGAGGTTTTCTCTTGTTTTGTTCTACCTTGAACTTATATGTTCCTTGGTTAGTCTAGGGGACATAAATTTCGTATGGCCAAAAGTTGGGGGCGCTTCTCTTTCTGCCTCCCCTTCCGAATGCATAGATGAAAATTTTCTATATCATGTCACGAAGCACAAGGAATTCGTTGACAGTGAGAGCACATTATTTTCAAGCATCGTTGAGGTTTAAGTTAAAAGGTATCTTGGCGGATACAAGCAATTTGACCTCAAGGGCATTGTCATTTTAACAATAACTTGATTTTGGATTCTTGGAAAAACTTGATATTGGGTCTGTTTTGTAGGTGTCCAACTGGCTTCAAATGTGGTATAAACTACCAGCCTCCAACAGTTGTACCCGGGGGCGATTTAGCCTTGGTGCAGCGAGCTGTTTGCATGATCAGCAATAACACAGCAGTAGCTGAGGTGTTCTCTCGCATCGACCATAAATTCGACCTGATGTATGCGAAGAGAGCATTTGTTCACTGGTACGTCGGTGAGGGCATGGAAGAAGGGGAGTTCTCAGAGGCTCGTGAAGATCTGGCTGCTCTGGAGAAAGACTATGAAGAAGTTGGCGCTGAAGGTGCGGATGATGATGAGGAGCCTGAAGATTACTAA

mRNA sequence

ATGAGGGAGATCATAAGCATCCACATTGGACAGGCTGGGATTCAGGTCGGCAATTCTTGCTGGGAGCTCTATTGCCTCGAACATGGCATTCAGCCCGATGGTATGATGCCCAGTGATACCTCCGAAGGTGTAGCACACGACGCTTTTAATCCGTTTTTTAGCGAGACCGGTTCAGGCAAGCATGTGCCTCGGGCTATATTTGTTGATTTAGAACCAACGGTGATTGATGAAGTTAGAACTGGAGCCTACCGGCAGCTCTTTCATCCGGAGCAATTGATATCTGGAAAAGAAGATGCTGCTAATAATTTTGCCCGCGGACACTACACAGTTGGAAAGGAAATTGTAGATCTCTGTCTTGACCGGGTCAGGAAGTTGGCTGATAACTGCACCGGGTTACAAGGGTTTCTAGTCTTTAATGCTGTTGGTGGTGGCACTGGTTCTGGTTTGGGTTCGTTGTTGTTAGAGCGCTTGTCAGTGGATTATGGGAAGAAATCAAAGCTTGGTTTCACCATCTACCCATCTCCTCAGGTTTCAACTGCTGTCGTGGAGCCTTACAACAGCGTTCTTTCTACTCATTCTCTTCTTGAGCATACGGATGTTGCTGTTCTTCTAGACAATGAAGCTATATACGACATTTGTAGGAGATCTCTTGATATCGATAGGCCTACATATACCAACTTGAATAGATTGATATCTCAAATTATTTCATCCTTAACCACTTCATTGAGATTTGATGGAGCCATCAACGTGGACATAACCGAGTTCCAGACGAACCTTGTACCATATCCTCGCATTCATTTCATGCTCTCCTCATATGCTCCGGTTATCTCAGCAGAGAAGGCTTACCACGAACAGCTATCTGTACCTGAGATCACAAATGCAGTTTTTGAGCCTTCAAGCATGATGGCAAAATGTGATCCTAGGCATGGGAAATACATGGCTTGTTGCTTAATGTACCGAGGAGATGTTGTACCCAAAGATGTCAATGCTGCTGTTGCTACCATTAAGACGAAGCGGACCGTGCAGTTTGTTGACTGGTGTCCAACTGGCTTCAAATGTGGTATAAACTACCAGCCTCCAACAGTTGTACCCGGGGGCGATTTAGCCTTGGTGCAGCGAGCTGTTTGCATGATCAGCAATAACACAGCAGTAGCTGAGGTGTTCTCTCGCATCGACCATAAATTCGACCTGATGTATGCGAAGAGAGCATTTGTTCACTGGTACGTCGGTGAGGGCATGGAAGAAGGGGAGTTCTCAGAGGCTCGTGAAGATCTGGCTGCTCTGGAGAAAGACTATGAAGAAGTTGGCGCTGAAGGTGCGGATGATGATGAGGAGCCTGAAGATTACTAA

Coding sequence (CDS)

ATGAGGGAGATCATAAGCATCCACATTGGACAGGCTGGGATTCAGGTCGGCAATTCTTGCTGGGAGCTCTATTGCCTCGAACATGGCATTCAGCCCGATGGTATGATGCCCAGTGATACCTCCGAAGGTGTAGCACACGACGCTTTTAATCCGTTTTTTAGCGAGACCGGTTCAGGCAAGCATGTGCCTCGGGCTATATTTGTTGATTTAGAACCAACGGTGATTGATGAAGTTAGAACTGGAGCCTACCGGCAGCTCTTTCATCCGGAGCAATTGATATCTGGAAAAGAAGATGCTGCTAATAATTTTGCCCGCGGACACTACACAGTTGGAAAGGAAATTGTAGATCTCTGTCTTGACCGGGTCAGGAAGTTGGCTGATAACTGCACCGGGTTACAAGGGTTTCTAGTCTTTAATGCTGTTGGTGGTGGCACTGGTTCTGGTTTGGGTTCGTTGTTGTTAGAGCGCTTGTCAGTGGATTATGGGAAGAAATCAAAGCTTGGTTTCACCATCTACCCATCTCCTCAGGTTTCAACTGCTGTCGTGGAGCCTTACAACAGCGTTCTTTCTACTCATTCTCTTCTTGAGCATACGGATGTTGCTGTTCTTCTAGACAATGAAGCTATATACGACATTTGTAGGAGATCTCTTGATATCGATAGGCCTACATATACCAACTTGAATAGATTGATATCTCAAATTATTTCATCCTTAACCACTTCATTGAGATTTGATGGAGCCATCAACGTGGACATAACCGAGTTCCAGACGAACCTTGTACCATATCCTCGCATTCATTTCATGCTCTCCTCATATGCTCCGGTTATCTCAGCAGAGAAGGCTTACCACGAACAGCTATCTGTACCTGAGATCACAAATGCAGTTTTTGAGCCTTCAAGCATGATGGCAAAATGTGATCCTAGGCATGGGAAATACATGGCTTGTTGCTTAATGTACCGAGGAGATGTTGTACCCAAAGATGTCAATGCTGCTGTTGCTACCATTAAGACGAAGCGGACCGTGCAGTTTGTTGACTGGTGTCCAACTGGCTTCAAATGTGGTATAAACTACCAGCCTCCAACAGTTGTACCCGGGGGCGATTTAGCCTTGGTGCAGCGAGCTGTTTGCATGATCAGCAATAACACAGCAGTAGCTGAGGTGTTCTCTCGCATCGACCATAAATTCGACCTGATGTATGCGAAGAGAGCATTTGTTCACTGGTACGTCGGTGAGGGCATGGAAGAAGGGGAGTTCTCAGAGGCTCGTGAAGATCTGGCTGCTCTGGAGAAAGACTATGAAGAAGTTGGCGCTGAAGGTGCGGATGATGATGAGGAGCCTGAAGATTACTAA

Protein sequence

MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNPFFSETGSGKHVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDRVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLALVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAEGADDDEEPEDY
BLAST of Cla003129 vs. Swiss-Prot
Match: TBA1_ARATH (Tubulin alpha-1 chain OS=Arabidopsis thaliana GN=TUBA1 PE=2 SV=1)

HSP 1 Score: 847.4 bits (2188), Expect = 7.0e-245
Identity = 411/450 (91.33%), Postives = 428/450 (95.11%), Query Frame = 1

Query: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNPFFSETGSGK 60
           MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD++ G  HDAFN FFSET SG+
Sbjct: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDSTVGACHDAFNTFFSETSSGQ 60

Query: 61  HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120
           HVPRA+F+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVG+EIVD CL+
Sbjct: 61  HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDTCLE 120

Query: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180
           R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVD+GKKSKLGFTIYPSPQVSTA
Sbjct: 121 RLRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDFGKKSKLGFTIYPSPQVSTA 180

Query: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLISQIISSLTT 240
           VVEPYNSVLSTHSLLEHTDV VLLDNEAIYDICRRSLDI+RPTY+NLNRLISQ ISSLTT
Sbjct: 181 VVEPYNSVLSTHSLLEHTDVVVLLDNEAIYDICRRSLDIERPTYSNLNRLISQTISSLTT 240

Query: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS 300
           SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVIS+ KAYHEQ SVPEIT +VFEPS+
Sbjct: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISSAKAYHEQFSVPEITTSVFEPSN 300

Query: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360
           MMAKCDPRHGKYMACCLMYRGDVVPKDVN AVA IK KRT+QFVDWCPTGFKCGINYQPP
Sbjct: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNTAVAAIKAKRTIQFVDWCPTGFKCGINYQPP 360

Query: 361 TVVPGGDLALVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420
           +VVPGGDLA VQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct: 361 SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE 420

Query: 421 AREDLAALEKDYEEVGAEGA-DDDEEPEDY 450
           AREDLAALEKDYEEVG EGA DDDEE ++Y
Sbjct: 421 AREDLAALEKDYEEVGGEGAEDDDEEGDEY 450

BLAST of Cla003129 vs. Swiss-Prot
Match: TBA_OXYGR (Tubulin alpha chain OS=Oxytricha granulifera PE=3 SV=1)

HSP 1 Score: 835.1 bits (2156), Expect = 3.6e-241
Identity = 399/447 (89.26%), Postives = 424/447 (94.85%), Query Frame = 1

Query: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNPFFSETGSGK 60
           MRE+ISIH+GQAGIQVGN+CWEL+CLEHGIQPDG MPSD + G   DAFN FFSETG+GK
Sbjct: 1   MREVISIHVGQAGIQVGNACWELFCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK 60

Query: 61  HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120
           HVPR +F+DLEPTV DEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct: 61  HVPRCVFLDLEPTVDDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD 120

Query: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180
           R+RKLAD CTGLQGFLVFN+VGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTA
Sbjct: 121 RIRKLADQCTGLQGFLVFNSVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA 180

Query: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLISQIISSLTT 240
           VVEPYNSVLSTHSLLEHTDVAV+LDNEA+YDICRR+LDI+RPTYTNLNRLI+Q+ISSLT 
Sbjct: 181 VVEPYNSVLSTHSLLEHTDVAVMLDNEAVYDICRRNLDIERPTYTNLNRLIAQVISSLTA 240

Query: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS 300
           SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV EITN+ FEP+S
Sbjct: 241 SLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPAS 300

Query: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360
           MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP 360

Query: 361 TVVPGGDLALVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420
           TVVPGGDLA V RAVCMISN+TA+AEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
Sbjct: 361 TVVPGGDLAKVMRAVCMISNSTAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420

Query: 421 AREDLAALEKDYEEVGAEGADDDEEPE 448
           AREDLAALEKDYEEVG E A+ + E E
Sbjct: 421 AREDLAALEKDYEEVGIETAEGEGEEE 447

BLAST of Cla003129 vs. Swiss-Prot
Match: TBA2_CHLRE (Tubulin alpha-2 chain OS=Chlamydomonas reinhardtii GN=TUBA2 PE=1 SV=1)

HSP 1 Score: 832.0 bits (2148), Expect = 3.1e-240
Identity = 400/447 (89.49%), Postives = 422/447 (94.41%), Query Frame = 1

Query: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNPFFSETGSGK 60
           MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD + G   DAFN FFSETG+GK
Sbjct: 1   MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK 60

Query: 61  HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120
           HVPR IF+DLEPTV+DEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDL LD
Sbjct: 61  HVPRCIFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLALD 120

Query: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180
           R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTA
Sbjct: 121 RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA 180

Query: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLISQIISSLTT 240
           VVEPYNSVLSTHSLLEHTDVAV+LDNEAIYDICRRSLDI+RPTYTNLNRLI+Q+ISSLT 
Sbjct: 181 VVEPYNSVLSTHSLLEHTDVAVMLDNEAIYDICRRSLDIERPTYTNLNRLIAQVISSLTA 240

Query: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS 300
           SLRFDGA+NVDITEFQTNLVPYPRIHFMLSSYAP+ISAEKAYHEQLSV EITNA FEP+S
Sbjct: 241 SLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPIISAEKAYHEQLSVAEITNAAFEPAS 300

Query: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360
           MM KCDP HGKYMACCLMYRGDVVPKDVNA+VATIKTKRT+QFVDWCPTGFKCGINYQPP
Sbjct: 301 MMVKCDPLHGKYMACCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPP 360

Query: 361 TVVPGGDLALVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420
           TVVPG DLA VQRAVCMISN+TA+ E+FSR+DHKFDLMYAKRAFVHWYVGEGMEEGEFSE
Sbjct: 361 TVVPGVDLAKVQRAVCMISNSTAIGEIFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420

Query: 421 AREDLAALEKDYEEVGAEGADDDEEPE 448
           AREDLAALEKD+EEVGAE A+   E E
Sbjct: 421 AREDLAALEKDFEEVGAESAEGAGEGE 447

BLAST of Cla003129 vs. Swiss-Prot
Match: TBA_TETTH (Tubulin alpha chain OS=Tetrahymena thermophila PE=1 SV=1)

HSP 1 Score: 830.9 bits (2145), Expect = 6.8e-240
Identity = 396/449 (88.20%), Postives = 425/449 (94.65%), Query Frame = 1

Query: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNPFFSETGSGK 60
           MRE+ISIH+GQ GIQVGN+CWEL+CLEHGIQPDG MPSD + G   DAFN FFSETG+GK
Sbjct: 1   MREVISIHVGQGGIQVGNACWELFCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK 60

Query: 61  HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120
           HVPRA+F+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct: 61  HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD 120

Query: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180
           R+RKLADNCTGLQGFLVFN+VGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA
Sbjct: 121 RIRKLADNCTGLQGFLVFNSVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180

Query: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLISQIISSLTT 240
           VVEPYNS+LSTHSLLEHTDVAV+LDNEAIYDICRR+LDI+RPTYTNLNRLI+Q+ISSLT 
Sbjct: 181 VVEPYNSILSTHSLLEHTDVAVMLDNEAIYDICRRNLDIERPTYTNLNRLIAQVISSLTA 240

Query: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS 300
           SLRFDGA+NVDITEFQTNLVPYPRIHFMLSSYAP+ISAEKAYHEQLSV EITN+ FEP++
Sbjct: 241 SLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPIISAEKAYHEQLSVAEITNSAFEPAN 300

Query: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360
           MMAKCDPRHGKYMAC +MYRGDVVPKDVNA++ATIKTKRT+QFVDWCPTGFK GINYQPP
Sbjct: 301 MMAKCDPRHGKYMACSMMYRGDVVPKDVNASIATIKTKRTIQFVDWCPTGFKVGINYQPP 360

Query: 361 TVVPGGDLALVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420
           TVVPGGDLA V RAVCMISN+TA+AEVFSR+DHKFDLMYAKRAFVHWYVGEGMEEGEFSE
Sbjct: 361 TVVPGGDLAKVMRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420

Query: 421 AREDLAALEKDYEEVGAEGADDDEEPEDY 450
           AREDLAALEKDYEEVG E A+ + E E Y
Sbjct: 421 AREDLAALEKDYEEVGIETAEGEGEEEGY 449

BLAST of Cla003129 vs. Swiss-Prot
Match: TBA_TETPY (Tubulin alpha chain OS=Tetrahymena pyriformis PE=3 SV=1)

HSP 1 Score: 827.8 bits (2137), Expect = 5.8e-239
Identity = 395/449 (87.97%), Postives = 424/449 (94.43%), Query Frame = 1

Query: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNPFFSETGSGK 60
           MRE+ISIH+GQ GIQVGN+CWEL+CLEHGIQPDG MPSD + G   DAFN FFSETG+GK
Sbjct: 1   MREVISIHVGQGGIQVGNACWELFCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK 60

Query: 61  HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120
           HVPRA+F+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct: 61  HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD 120

Query: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180
           R+RKLADNCTGLQGFLVFN+VGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA
Sbjct: 121 RIRKLADNCTGLQGFLVFNSVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180

Query: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLISQIISSLTT 240
           VVEPYNS+LSTHSLLEHTDVAV+LDNEAIYDICRR+LDI+RPTYTNLNRLI+Q+ISSLT 
Sbjct: 181 VVEPYNSILSTHSLLEHTDVAVMLDNEAIYDICRRNLDIERPTYTNLNRLIAQVISSLTA 240

Query: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS 300
           SLRFDGA+NVDITEFQTNLVPYPRIHFMLSSYAP+ISAEKAYHEQLSV EITN+ FEP++
Sbjct: 241 SLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPIISAEKAYHEQLSVAEITNSAFEPAN 300

Query: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360
           MMAKCDPRHGKYMAC +MYRGDVVPKDVNA++ATIKTKRT+QFVDWCPTGFK GINYQP 
Sbjct: 301 MMAKCDPRHGKYMACSMMYRGDVVPKDVNASIATIKTKRTIQFVDWCPTGFKVGINYQPS 360

Query: 361 TVVPGGDLALVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420
           TVVPGGDLA V RAVCMISN+TA+AEVFSR+DHKFDLMYAKRAFVHWYVGEGMEEGEFSE
Sbjct: 361 TVVPGGDLAKVMRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420

Query: 421 AREDLAALEKDYEEVGAEGADDDEEPEDY 450
           AREDLAALEKDYEEVG E A+ + E E Y
Sbjct: 421 AREDLAALEKDYEEVGIETAEGEGEEEGY 449

BLAST of Cla003129 vs. TrEMBL
Match: A0A0A0KWR8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G268090 PE=3 SV=1)

HSP 1 Score: 906.0 bits (2340), Expect = 1.9e-260
Identity = 445/449 (99.11%), Postives = 447/449 (99.55%), Query Frame = 1

Query: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNPFFSETGSGK 60
           MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFN FFSETGSGK
Sbjct: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNTFFSETGSGK 60

Query: 61  HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120
           HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct: 61  HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120

Query: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180
           RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA
Sbjct: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180

Query: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLISQIISSLTT 240
           VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLISQIISSLTT
Sbjct: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLISQIISSLTT 240

Query: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS 300
           SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS
Sbjct: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS 300

Query: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360
           MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360

Query: 361 TVVPGGDLALVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420
           TVVPGGDLALVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
Sbjct: 361 TVVPGGDLALVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420

Query: 421 AREDLAALEKDYEEVGAEGADDDEEPEDY 450
           AREDLAALEKDYEEVGAEGADDD++ EDY
Sbjct: 421 AREDLAALEKDYEEVGAEGADDDDDHEDY 449

BLAST of Cla003129 vs. TrEMBL
Match: B9T1E6_RICCO (Tubulin alpha chain, putative OS=Ricinus communis GN=RCOM_1361220 PE=3 SV=1)

HSP 1 Score: 895.2 bits (2312), Expect = 3.3e-257
Identity = 439/449 (97.77%), Postives = 443/449 (98.66%), Query Frame = 1

Query: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNPFFSETGSGK 60
           MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTS GV HDAFN FFSETGSGK
Sbjct: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVGHDAFNTFFSETGSGK 60

Query: 61  HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120
           HVPRA+FVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct: 61  HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120

Query: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180
           RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA
Sbjct: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180

Query: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLISQIISSLTT 240
           VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDI+RPTYTNLNRLISQIISSLTT
Sbjct: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTT 240

Query: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS 300
           SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS
Sbjct: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS 300

Query: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360
           MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360

Query: 361 TVVPGGDLALVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420
           +VVPGGDLA VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
Sbjct: 361 SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420

Query: 421 AREDLAALEKDYEEVGAEGADDDEEPEDY 450
           AREDLAALEKDYEEVGAEG DD+EE EDY
Sbjct: 421 AREDLAALEKDYEEVGAEGGDDEEEGEDY 449

BLAST of Cla003129 vs. TrEMBL
Match: F6GUN1_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_06s0004g00480 PE=3 SV=1)

HSP 1 Score: 895.2 bits (2312), Expect = 3.3e-257
Identity = 439/449 (97.77%), Postives = 442/449 (98.44%), Query Frame = 1

Query: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNPFFSETGSGK 60
           MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDT+ GV HDAFN FFSETG+GK
Sbjct: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVGHDAFNTFFSETGAGK 60

Query: 61  HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120
           HVPRAIFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct: 61  HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120

Query: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180
           RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA
Sbjct: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180

Query: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLISQIISSLTT 240
           VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDI+RPTYTNLNRLISQIISSLTT
Sbjct: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTT 240

Query: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS 300
           SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS
Sbjct: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS 300

Query: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360
           MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360

Query: 361 TVVPGGDLALVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420
           TVVPGGDLA VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
Sbjct: 361 TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420

Query: 421 AREDLAALEKDYEEVGAEGADDDEEPEDY 450
           AREDLAALEKDYEEVGAEG DDDEE EDY
Sbjct: 421 AREDLAALEKDYEEVGAEGVDDDEEAEDY 449

BLAST of Cla003129 vs. TrEMBL
Match: A0A0S3QZB8_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.01G114200 PE=3 SV=1)

HSP 1 Score: 894.0 bits (2309), Expect = 7.3e-257
Identity = 438/449 (97.55%), Postives = 444/449 (98.89%), Query Frame = 1

Query: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNPFFSETGSGK 60
           MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTS GVAHDAFN FFSETGSGK
Sbjct: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSFGVAHDAFNTFFSETGSGK 60

Query: 61  HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120
           HVPRA+FVDLEPTVIDEVR GAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct: 61  HVPRAVFVDLEPTVIDEVRCGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120

Query: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180
           RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA
Sbjct: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180

Query: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLISQIISSLTT 240
           VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDI+RPTYTNLNRLISQIISSLTT
Sbjct: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTT 240

Query: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS 300
           SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISA KAYHEQLSVPEITNAVFEP+S
Sbjct: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPAS 300

Query: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360
           MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360

Query: 361 TVVPGGDLALVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420
           +VVPGGDLA VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
Sbjct: 361 SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420

Query: 421 AREDLAALEKDYEEVGAEGADDDEEPEDY 450
           AREDLAALEKDYEEVGAEGA+D+EEPEDY
Sbjct: 421 AREDLAALEKDYEEVGAEGAEDEEEPEDY 449

BLAST of Cla003129 vs. TrEMBL
Match: A0A0L9TKB7_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan01g048600 PE=3 SV=1)

HSP 1 Score: 894.0 bits (2309), Expect = 7.3e-257
Identity = 438/449 (97.55%), Postives = 444/449 (98.89%), Query Frame = 1

Query: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNPFFSETGSGK 60
           MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTS GVAHDAFN FFSETGSGK
Sbjct: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSFGVAHDAFNTFFSETGSGK 60

Query: 61  HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120
           HVPRA+FVDLEPTVIDEVR GAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct: 61  HVPRAVFVDLEPTVIDEVRCGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120

Query: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180
           RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA
Sbjct: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180

Query: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLISQIISSLTT 240
           VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDI+RPTYTNLNRLISQIISSLTT
Sbjct: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTT 240

Query: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS 300
           SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISA KAYHEQLSVPEITNAVFEP+S
Sbjct: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPAS 300

Query: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360
           MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360

Query: 361 TVVPGGDLALVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420
           +VVPGGDLA VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
Sbjct: 361 SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420

Query: 421 AREDLAALEKDYEEVGAEGADDDEEPEDY 450
           AREDLAALEKDYEEVGAEGA+D+EEPEDY
Sbjct: 421 AREDLAALEKDYEEVGAEGAEDEEEPEDY 449

BLAST of Cla003129 vs. NCBI nr
Match: gi|720005371|ref|XP_010257632.1| (PREDICTED: tubulin alpha-3 chain [Nelumbo nucifera])

HSP 1 Score: 893.3 bits (2307), Expect = 1.8e-256
Identity = 439/449 (97.77%), Postives = 443/449 (98.66%), Query Frame = 1

Query: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNPFFSETGSGK 60
           MREIISIHIGQAGIQVGNSCWELYCLEH IQPDGMMPSDTS GVAHDAFN FFSETG+GK
Sbjct: 1   MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVAHDAFNTFFSETGAGK 60

Query: 61  HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120
           HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct: 61  HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120

Query: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180
           RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA
Sbjct: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180

Query: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLISQIISSLTT 240
           VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRR+LDI+RPTYTNLNRLISQIISSLTT
Sbjct: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRALDIERPTYTNLNRLISQIISSLTT 240

Query: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS 300
           SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS
Sbjct: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS 300

Query: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360
           MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360

Query: 361 TVVPGGDLALVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420
           TVVPGGDLA VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
Sbjct: 361 TVVPGGDLARVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420

Query: 421 AREDLAALEKDYEEVGAEGADDDEEPEDY 450
           AREDLAALEKDYEEVGAEG DD+EE EDY
Sbjct: 421 AREDLAALEKDYEEVGAEGVDDEEEGEDY 449

BLAST of Cla003129 vs. NCBI nr
Match: gi|363814487|ref|NP_001242878.1| (uncharacterized protein LOC100806907 [Glycine max])

HSP 1 Score: 886.3 bits (2289), Expect = 2.2e-254
Identity = 435/449 (96.88%), Postives = 441/449 (98.22%), Query Frame = 1

Query: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNPFFSETGSGK 60
           MREIISIHIGQAGIQVGNSCW LYCLEHGIQPDGMMPSD+S GVAHDAFN FFSETGSGK
Sbjct: 1   MREIISIHIGQAGIQVGNSCWGLYCLEHGIQPDGMMPSDSSFGVAHDAFNTFFSETGSGK 60

Query: 61  HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120
           HVPRA+FVDLEPTVIDEVR G YRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD
Sbjct: 61  HVPRAVFVDLEPTVIDEVRCGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120

Query: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180
           RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA
Sbjct: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180

Query: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLISQIISSLTT 240
           VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDI+RPTYTNLNRLISQIISSLTT
Sbjct: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTT 240

Query: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS 300
           SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISA KAYHEQLSVPEITNAVFEP+S
Sbjct: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPAS 300

Query: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360
           MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360

Query: 361 TVVPGGDLALVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420
           +VVPGGDLA VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
Sbjct: 361 SVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420

Query: 421 AREDLAALEKDYEEVGAEGADDDEEPEDY 450
           AREDLAALEKDYEEVGAEGA+DDEE EDY
Sbjct: 421 AREDLAALEKDYEEVGAEGAEDDEEGEDY 449

BLAST of Cla003129 vs. NCBI nr
Match: gi|590582591|ref|XP_007014666.1| (Tubulin alpha-5 [Theobroma cacao])

HSP 1 Score: 885.9 bits (2288), Expect = 2.8e-254
Identity = 434/449 (96.66%), Postives = 441/449 (98.22%), Query Frame = 1

Query: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNPFFSETGSGK 60
           MREIISIHIGQAGIQVGNSCWELYCLEH I PDGMMPSDTS GVAHDAFN FFSETGSGK
Sbjct: 1   MREIISIHIGQAGIQVGNSCWELYCLEHEIHPDGMMPSDTSVGVAHDAFNTFFSETGSGK 60

Query: 61  HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120
           HVPRAIFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct: 61  HVPRAIFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD 120

Query: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180
           RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA
Sbjct: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180

Query: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLISQIISSLTT 240
           VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDI+RPTYTNLNRLISQIISSLTT
Sbjct: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTT 240

Query: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS 300
           SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVPEITNAVFEP+S
Sbjct: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVPEITNAVFEPAS 300

Query: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360
           MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAV+TIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVSTIKTKRTVQFVDWCPTGFKCGINYQPP 360

Query: 361 TVVPGGDLALVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420
           TVVPGGDLA VQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
Sbjct: 361 TVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420

Query: 421 AREDLAALEKDYEEVGAEGADDDEEPEDY 450
           AREDLAALEKDYEEVGAEG +D+EE EDY
Sbjct: 421 AREDLAALEKDYEEVGAEGVEDEEEGEDY 449

BLAST of Cla003129 vs. NCBI nr
Match: gi|728825236|gb|KHG06160.1| (Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum])

HSP 1 Score: 885.6 bits (2287), Expect = 3.7e-254
Identity = 432/449 (96.21%), Postives = 442/449 (98.44%), Query Frame = 1

Query: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNPFFSETGSGK 60
           MREIISIHIGQAGIQVGNSCWELYCLEH IQPDGMMPSDTS GVA+DAFN FFSETGSGK
Sbjct: 1   MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVANDAFNTFFSETGSGK 60

Query: 61  HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120
           HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct: 61  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD 120

Query: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180
           RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA
Sbjct: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180

Query: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLISQIISSLTT 240
           VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDI+RPTYTNLNRLISQIISSLTT
Sbjct: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTT 240

Query: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS 300
           SLRFDGAINVD+TEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS
Sbjct: 241 SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS 300

Query: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360
           MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360

Query: 361 TVVPGGDLALVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420
           TVVPGGDLA VQRAVCMISNNTAVAEVF+RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct: 361 TVVPGGDLAKVQRAVCMISNNTAVAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE 420

Query: 421 AREDLAALEKDYEEVGAEGADDDEEPEDY 450
           AREDLAALEKDYEEVGAEG +D+E+ EDY
Sbjct: 421 AREDLAALEKDYEEVGAEGVEDEEDAEDY 449

BLAST of Cla003129 vs. NCBI nr
Match: gi|823260765|ref|XP_012463107.1| (PREDICTED: tubulin alpha-3 chain [Gossypium raimondii])

HSP 1 Score: 885.2 bits (2286), Expect = 4.9e-254
Identity = 431/449 (95.99%), Postives = 442/449 (98.44%), Query Frame = 1

Query: 1   MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNPFFSETGSGK 60
           MREIISIHIGQAGIQVGNSCWELYCLEH IQPDGMMPSDTS GVA+DAFN FFSETGSGK
Sbjct: 1   MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVANDAFNTFFSETGSGK 60

Query: 61  HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD 120
           HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct: 61  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD 120

Query: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180
           RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA
Sbjct: 121 RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA 180

Query: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIDRPTYTNLNRLISQIISSLTT 240
           VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDI+RPTYTNLNRLISQIISSLTT
Sbjct: 181 VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTT 240

Query: 241 SLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSS 300
           SLRFDGAINVD+TEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLS+PEITNAVFEPSS
Sbjct: 241 SLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSIPEITNAVFEPSS 300

Query: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360
           MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP
Sbjct: 301 MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP 360

Query: 361 TVVPGGDLALVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE 420
           TVVPGGDLA VQRAVCMISNNTAVAEVF+RIDHKFDLMY+KRAFVHWYVGEGMEEGEFSE
Sbjct: 361 TVVPGGDLAKVQRAVCMISNNTAVAEVFARIDHKFDLMYSKRAFVHWYVGEGMEEGEFSE 420

Query: 421 AREDLAALEKDYEEVGAEGADDDEEPEDY 450
           AREDLAALEKDYEEVGAEG +D+E+ EDY
Sbjct: 421 AREDLAALEKDYEEVGAEGVEDEEDAEDY 449

The following BLAST results are available for this feature:
Match NameE-valueIdentityDescription
TBA1_ARATH7.0e-24591.33Tubulin alpha-1 chain OS=Arabidopsis thaliana GN=TUBA1 PE=2 SV=1[more]
TBA_OXYGR3.6e-24189.26Tubulin alpha chain OS=Oxytricha granulifera PE=3 SV=1[more]
TBA2_CHLRE3.1e-24089.49Tubulin alpha-2 chain OS=Chlamydomonas reinhardtii GN=TUBA2 PE=1 SV=1[more]
TBA_TETTH6.8e-24088.20Tubulin alpha chain OS=Tetrahymena thermophila PE=1 SV=1[more]
TBA_TETPY5.8e-23987.97Tubulin alpha chain OS=Tetrahymena pyriformis PE=3 SV=1[more]
Match NameE-valueIdentityDescription
A0A0A0KWR8_CUCSA1.9e-26099.11Uncharacterized protein OS=Cucumis sativus GN=Csa_4G268090 PE=3 SV=1[more]
B9T1E6_RICCO3.3e-25797.77Tubulin alpha chain, putative OS=Ricinus communis GN=RCOM_1361220 PE=3 SV=1[more]
F6GUN1_VITVI3.3e-25797.77Putative uncharacterized protein OS=Vitis vinifera GN=VIT_06s0004g00480 PE=3 SV=... [more]
A0A0S3QZB8_PHAAN7.3e-25797.55Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.01G114200 PE=... [more]
A0A0L9TKB7_PHAAN7.3e-25797.55Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan01g048600 PE=3 SV=1[more]
Match NameE-valueIdentityDescription
gi|720005371|ref|XP_010257632.1|1.8e-25697.77PREDICTED: tubulin alpha-3 chain [Nelumbo nucifera][more]
gi|363814487|ref|NP_001242878.1|2.2e-25496.88uncharacterized protein LOC100806907 [Glycine max][more]
gi|590582591|ref|XP_007014666.1|2.8e-25496.66Tubulin alpha-5 [Theobroma cacao][more]
gi|728825236|gb|KHG06160.1|3.7e-25496.21Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum][more]
gi|823260765|ref|XP_012463107.1|4.9e-25495.99PREDICTED: tubulin alpha-3 chain [Gossypium raimondii][more]
The following terms have been associated with this mRNA:
Vocabulary: INTERPRO
TermDefinition
IPR000217Tubulin
IPR002452Alpha_tubulin
IPR003008Tubulin_FtsZ_GTPase
IPR008280Tub_FtsZ_C
IPR013838Beta-tubulin_BS
IPR017975Tubulin_CS
IPR018316Tubulin/FtsZ_2-layer-sand-dom
IPR023123Tubulin_C
Vocabulary: Cellular Component
TermDefinition
GO:0005874microtubule
Vocabulary: Biological Process
TermDefinition
GO:0007017microtubule-based process
Vocabulary: Molecular Function
TermDefinition
GO:0005200structural constituent of cytoskeleton
GO:0005525GTP binding
GO:0003924GTPase activity
GO Assignments
This mRNA is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007017 microtubule-based process
biological_process GO:0008152 metabolic process
biological_process GO:0051258 protein polymerization
cellular_component GO:0005874 microtubule
cellular_component GO:0005737 cytoplasm
molecular_function GO:0003924 GTPase activity
molecular_function GO:0005525 GTP binding
molecular_function GO:0005200 structural constituent of cytoskeleton

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameType
Cla003129Cla003129gene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameType
Cla003129Cla003129.1-proteinpolypeptide


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameType
Cla003129.1.cds5Cla003129.1.cds5CDS
Cla003129.1.cds4Cla003129.1.cds4CDS
Cla003129.1.cds3Cla003129.1.cds3CDS
Cla003129.1.cds2Cla003129.1.cds2CDS
Cla003129.1.cds1Cla003129.1.cds1CDS


Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000217TubulinPRINTSPR01161TUBULINcoord: 10..30
score: 1.4E-91coord: 108..132
score: 1.4E-91coord: 134..152
score: 1.4E-91coord: 153..174
score: 1.4E-91coord: 380..408
score: 1.4E-91coord: 95..106
score: 1.4E-91coord: 178..191
score: 1.4E-91coord: 192..212
score: 1.4E-91coord: 53..72
score: 1.4
IPR000217TubulinPANTHERPTHR11588TUBULINcoord: 2..449
score:
IPR002452Alpha tubulinPRINTSPR01162ALPHATUBULINcoord: 88..101
score: 2.8E-116coord: 214..226
score: 2.8E-116coord: 422..438
score: 2.8E-116coord: 385..401
score: 2.8E-116coord: 18..33
score: 2.8E-116coord: 148..160
score: 2.8E-116coord: 347..360
score: 2.8E-116coord: 274..289
score: 2.8E-116coord: 321..342
score: 2.8E-116coord: 161..172
score: 2.8E-116coord: 360..379
score: 2.8E-116coord: 45..58
score: 2.8E-116coord: 120..128
score: 2.8E
IPR003008Tubulin/FtsZ, GTPase domainGENE3DG3DSA:3.40.50.1440coord: 1..268
score: 1.1E
IPR003008Tubulin/FtsZ, GTPase domainPFAMPF00091Tubulincoord: 3..213
score: 2.8
IPR003008Tubulin/FtsZ, GTPase domainSMARTSM00864Tubulin_4coord: 49..246
score: 5.2
IPR003008Tubulin/FtsZ, GTPase domainunknownSSF52490Tubulin nucleotide-binding domain-likecoord: 1..244
score: 6.15
IPR008280Tubulin/FtsZ, C-terminalunknownSSF55307Tubulin C-terminal domain-likecoord: 246..435
score: 1.16
IPR013838Beta tubulin, autoregulation binding sitePROSITEPS00228TUBULIN_B_AUTOREGcoord: 1..4
scor
IPR017975Tubulin, conserved sitePROSITEPS00227TUBULINcoord: 142..148
scor
IPR018316Tubulin/FtsZ, 2-layer sandwich domainGENE3DG3DSA:3.30.1330.20coord: 269..383
score: 2.8
IPR018316Tubulin/FtsZ, 2-layer sandwich domainPFAMPF03953Tubulin_Ccoord: 263..391
score: 1.2
IPR018316Tubulin/FtsZ, 2-layer sandwich domainSMARTSM00865Tubulin_C_4coord: 248..393
score: 8.2
IPR023123Tubulin, C-terminalGENE3DG3DSA:1.10.287.600coord: 385..438
score: 7.3
NoneNo IPR availableunknownCoilCoilcoord: 418..438
scor
NoneNo IPR availablePANTHERPTHR11588:SF48TUBULIN ALPHA-1 CHAIN-RELATEDcoord: 2..449
score: