Arabidopsis blast output of UN98045
BLASTX 7.6.2 Query= UN98045 /QuerySize=271 (270 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G26300.1 | Symbols: emb1027 | emb1027 (embryo ... 63 3e-011 TAIR9_protein||AT1G66530.1 | Symbols: | arginyl-tRNA synthetase... 60 2e-010 >TAIR9_protein||AT4G26300.1 | Symbols: emb1027 | emb1027 (embryo defective 1027); ATP binding / aminoacyl-tRNA ligase/ arginine-tRNA ligase/ nucleotide binding | chr4:13308400-13313109 REVERSE Length = 643 Score = 63 bits (151), Expect = 3e-011 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 6/68 (8%) Frame = -3 Query: 241 EDINELMKASELILEKNKQWGELEERALEVHLLEFTQALKESCSYLSPHILCEYLYGLSK 62 +DI+EL K +L L+ +ERAL +HLL F + ++E+C+ L P +LCEYLY LS+ Sbjct: 543 KDIDELKKTGKLALD------HADERALGLHLLRFAETVEEACTNLLPSVLCEYLYNLSE 596 Query: 61 KFINYYSS 38 F +YS+ Sbjct: 597 HFTRFYSN 604 >TAIR9_protein||AT1G66530.1 | Symbols: | arginyl-tRNA synthetase, putative / arginine--tRNA ligase, putative | chr1:24819064-24822277 REVERSE Length = 591 Score = 60 bits (145), Expect = 2e-010 Identities = 28/68 (41%), Positives = 47/68 (69%), Gaps = 6/68 (8%) Frame = -3 Query: 241 EDINELMKASELILEKNKQWGELEERALEVHLLEFTQALKESCSYLSPHILCEYLYGLSK 62 +DI+EL K ++ L+ ERAL +HLL+F + ++E+C+ L P++LC+YLY LS+ Sbjct: 491 KDIDELKKTGKIALD------HAAERALGLHLLQFAETVEEACTTLLPNVLCKYLYYLSE 544 Query: 61 KFINYYSS 38 +F +YS+ Sbjct: 545 EFTKFYSN 552 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,683,176,978 Number of Sequences: 33410 Number of Extensions: 18683176978 Number of Successful Extensions: 821770392 Number of sequences better than 0.0: 0 |