GenBank blast output of UN94137
BLASTX 7.6.2 Query= UN94137 /QuerySize=207 (206 letters) Database: GenBank nr; 20,571,509 sequences; 7,061,663,739 total letters Score E Sequences producing significant alignments: (bits) Value gi|224085750|ref|XP_002307688.1| predicted protein [Populus tric... 57 1e-006 >gi|224085750|ref|XP_002307688.1| predicted protein [Populus trichocarpa] Length = 436 Score = 57 bits (136), Expect = 1e-006 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = -3 Query: 117 LFHKWCTQHNKSYTTQEETVYRLSVFEKNYEYIMQHNS 4 LF WC +H KSYT+QEE +RL VFE NY+++ +HNS Sbjct: 28 LFETWCKEHGKSYTSQEERSHRLKVFEDNYDFVTKHNS 65 Database: GenBank nr Posted date: Thu Sep 27 19:07:00 2012 Number of letters in database: 7,061,663,739 Number of sequences in database: 20,571,509 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,459,609,229,667 Number of Sequences: 20571509 Number of Extensions: 6459609229667 Number of Successful Extensions: 1684068873 Number of sequences better than 0.0: 0 |