Arabidopsis blast output of UN90349
BLASTX 7.6.2 Query= UN90349 /QuerySize=1871 (1870 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G02110.1 | Symbols: | transcription coactivat... 119 1e-026 TAIR9_protein||AT4G02560.1 | Symbols: LD | LD (luminidependens);... 58 2e-008 >TAIR9_protein||AT4G02110.1 | Symbols: | transcription coactivator | chr4:935191-940191 FORWARD Length = 1330 Score = 119 bits (296), Expect = 1e-026 Identities = 51/85 (60%), Positives = 65/85 (76%) Frame = -2 Query: 843 LKELRPFFAVAASGRWILKTDYLTASNQAGKFLAEEPYEWHKNGLSEDGQINLEAQRKWR 664 ++ FFA AASG WILKTDY+ S +AGK L EEPYEWH +GLS DG INLE+ +KWR Sbjct: 1142 IRRTEKFFAAAASGSWILKTDYVADSKEAGKLLQEEPYEWHSSGLSADGAINLESPKKWR 1201 Query: 663 LLKEKNGYGAFHGM*IVIYGECIAP 589 L++EK G+GA +G+ IV+YG+C P Sbjct: 1202 LVREKTGHGALYGLRIVVYGDCTIP 1226 Score = 70 bits (170), Expect = 4e-012 Identities = 32/53 (60%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Frame = -1 Query: 979 EFVIFTGHSLQRREFQHLIRRLKGRVCKVSHQWSYQVTHFIVPDPIKRTETFF 821 +F I +G QR E+Q +IRRLKG+ C+ SHQWSYQ THFI P+ I+RTE FF Sbjct: 1098 KFFIVSGPRSQRNEYQQIIRRLKGKCCRDSHQWSYQATHFIAPE-IRRTEKFF 1149 >TAIR9_protein||AT4G02560.1 | Symbols: LD | LD (luminidependens); transcription factor | chr4:1123656-1128252 REVERSE Length = 954 Score = 58 bits (138), Expect = 2e-008 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = -2 Query: 1230 SWLT*AAIEEHTAVLHGILLVLCHLPLHEALSTHTSGVFQSVNKLRFYHRS 1078 +WL+ AA EE T+VL IL VLCHLPLH+A + S + QSVN LRFY S Sbjct: 243 TWLSQAASEEQTSVLLLILKVLCHLPLHKASPENMSAILQSVNGLRFYRIS 293 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,480,676,274 Number of Sequences: 33410 Number of Extensions: 18480676274 Number of Successful Extensions: 813644448 Number of sequences better than 0.0: 0 |