Arabidopsis blast output of UN87528
BLASTX 7.6.2 Query= UN87528 /QuerySize=1634 (1633 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G51410.1 | Symbols: | LUC7 N_terminus domain-... 83 4e-016 TAIR9_protein||AT5G51410.2 | Symbols: | LUC7 N_terminus domain-... 83 4e-016 >TAIR9_protein||AT5G51410.1 | Symbols: | LUC7 N_terminus domain-containing protein | chr5:20881821-20883577 REVERSE Length = 335 Score = 83 bits (204), Expect = 4e-016 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -1 Query: 649 AQNWTEEERRGHKESKWDDKEVCGFYMLKFCPHDLFVNTKSDLG 518 A+N T+EERRG KE KWDD+EVC FYM++FCPHDLFVNTKSDLG Sbjct: 15 ARNLTDEERRGFKEVKWDDREVCAFYMVRFCPHDLFVNTKSDLG 58 >TAIR9_protein||AT5G51410.2 | Symbols: | LUC7 N_terminus domain-containing protein | chr5:20881821-20883577 REVERSE Length = 335 Score = 83 bits (204), Expect = 4e-016 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -1 Query: 649 AQNWTEEERRGHKESKWDDKEVCGFYMLKFCPHDLFVNTKSDLG 518 A+N T+EERRG KE KWDD+EVC FYM++FCPHDLFVNTKSDLG Sbjct: 15 ARNLTDEERRGFKEVKWDDREVCAFYMVRFCPHDLFVNTKSDLG 58 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,940,410,007 Number of Sequences: 33410 Number of Extensions: 17940410007 Number of Successful Extensions: 788445170 Number of sequences better than 0.0: 0 |