Arabidopsis blast output of UN85133
BLASTX 7.6.2 Query= UN85133 /QuerySize=651 (650 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G20130.1 | Symbols: | hydrolase, acting on es... 47 9e-006 >TAIR9_protein||AT1G20130.1 | Symbols: | hydrolase, acting on ester bonds / lipase/ structural constituent of cell wall | chr1:6977939-6980003 FORWARD Length = 535 Score = 47 bits (110), Expect = 9e-006 Identities = 23/54 (42%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = -2 Query: 601 PKPQPKPIRPPTIP--PPKPPPNTQTTARPVPVESPKTTVPPKRNEPKPMSFCP 446 PKPQPKP+ PP P PPKP P P P P P + PKP + P Sbjct: 113 PKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTP 166 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,586,108,785 Number of Sequences: 33410 Number of Extensions: 5586108785 Number of Successful Extensions: 164544687 Number of sequences better than 0.0: 0 |