Arabidopsis blast output of UN75028
BLASTX 7.6.2 Query= UN75028 /QuerySize=914 (913 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G52180.1 | Symbols: ATPTPKIS1, DSP4, SEX4 | SE... 54 1e-007 >TAIR9_protein||AT3G52180.1 | Symbols: ATPTPKIS1, DSP4, SEX4 | SEX4 (STARCH-EXCESS 4); polysaccharide binding / protein tyrosine/serine/threonine phosphatase | chr3:19349884-19353459 REVERSE Length = 380 Score = 54 bits (128), Expect = 1e-007 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = -2 Query: 366 EGRYEYKYIVDGEWMINTNEPTTPVNKDGHINNYVQ 259 EG++EYKYI+DGEW N EP NKDGH NNY + Sbjct: 301 EGQFEYKYIIDGEWTHNEAEPFIGPNKDGHTNNYAK 336 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,214,858,267 Number of Sequences: 33410 Number of Extensions: 15214858267 Number of Successful Extensions: 666449473 Number of sequences better than 0.0: 0 |