Arabidopsis blast output of UN71764
BLASTX 7.6.2 Query= UN71764 /QuerySize=1109 (1108 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G02930.1 | Symbols: | elongation factor Tu, p... 60 2e-009 TAIR9_protein||AT4G20360.1 | Symbols: ATRAB8D, ATRABE1B | ATRABE... 49 5e-006 >TAIR9_protein||AT4G02930.1 | Symbols: | elongation factor Tu, putative / EF-Tu, putative | chr4:1295751-1298354 REVERSE Length = 455 Score = 60 bits (144), Expect = 2e-009 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -2 Query: 678 LVQHVGVPSLVCFLNKVDAVDDPKLLELVELELR 577 L + VGVPSLVCFLNKVD VDDP+LLELVE+ELR Sbjct: 177 LARQVGVPSLVCFLNKVDVVDDPELLELVEMELR 210 >TAIR9_protein||AT4G20360.1 | Symbols: ATRAB8D, ATRABE1B | ATRABE1B (ARABIDOPSIS RAB GTPASE HOMOLOG E1B); GTP binding / GTPase/ translation elongation factor | chr4:10990036-10991466 FORWARD Length = 477 Score = 49 bits (115), Expect = 5e-006 Identities = 27/55 (49%), Positives = 34/55 (61%) Frame = -2 Query: 678 LVQHVGVPSLVCFLNKVDAVDDPKLLELVELELRGKIRSCHLFKVRVNLISNMTL 514 L + VGVP +V FLNK D VDD +LLELVELE+R + S + +IS L Sbjct: 189 LAKQVGVPDMVVFLNKEDQVDDAELLELVELEVRELLSSYEFNGDDIPIISGSAL 243 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,614,428,738 Number of Sequences: 33410 Number of Extensions: 14614428738 Number of Successful Extensions: 640877097 Number of sequences better than 0.0: 0 |