Arabidopsis blast output of UN65670
BLASTX 7.6.2 Query= UN65670 /QuerySize=703 (702 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G15530.1 | Symbols: BCCP2, CAC1-B | BCCP2 (BIO... 61 7e-010 TAIR9_protein||AT5G16390.1 | Symbols: CAC1, CAC1A, BCCP, BCCP1 |... 60 9e-010 TAIR9_protein||AT5G16390.2 | Symbols: CAC1, CAC1A, BCCP, BCCP1, ... 60 9e-010 >TAIR9_protein||AT5G15530.1 | Symbols: BCCP2, CAC1-B | BCCP2 (BIOTIN CARBOXYL CARRIER PROTEIN 2); biotin binding | chr5:5038955-5040437 FORWARD Length = 256 Score = 61 bits (146), Expect = 7e-010 Identities = 27/46 (58%), Positives = 39/46 (84%) Frame = -2 Query: 278 TTVPDAASITAFMTQVASLVQLVDSRDIMELELKQQNCEVLIRKKE 141 T VP+ A ++ FM +V+ L++LVDS+DI+ELELKQ +CE++IRKKE Sbjct: 78 TNVPEPAELSEFMAKVSGLLKLVDSKDIVELELKQLDCEIVIRKKE 123 >TAIR9_protein||AT5G16390.1 | Symbols: CAC1, CAC1A, BCCP, BCCP1 | CAC1 (CHLOROPLASTIC ACETYLCOENZYME A CARBOXYLASE 1); acetyl-CoA carboxylase/ biotin binding | chr5:5361098-5363020 REVERSE Length = 281 Score = 60 bits (145), Expect = 9e-010 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = -2 Query: 290 KEEDTTVPDAA---SITAFMTQVASLVQLVDSRDIMELELKQQNCEVLIRKKE 141 KE + P+ A SI+ F+TQV +LV+LVDSRDI+EL+LKQ +CE++IRKKE Sbjct: 93 KESSASSPELATEESISEFLTQVTTLVKLVDSRDIVELQLKQLDCELVIRKKE 145 >TAIR9_protein||AT5G16390.2 | Symbols: CAC1, CAC1A, BCCP, BCCP1, CAC1-A, BCCP-1 | CAC1 (CHLOROPLASTIC ACETYLCOENZYME A CARBOXYLASE 1); acetyl-CoA carboxylase/ biotin binding | chr5:5361554-5363020 REVERSE Length = 255 Score = 60 bits (145), Expect = 9e-010 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = -2 Query: 290 KEEDTTVPDAA---SITAFMTQVASLVQLVDSRDIMELELKQQNCEVLIRKKE 141 KE + P+ A SI+ F+TQV +LV+LVDSRDI+EL+LKQ +CE++IRKKE Sbjct: 93 KESSASSPELATEESISEFLTQVTTLVKLVDSRDIVELQLKQLDCELVIRKKE 145 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,357,021,289 Number of Sequences: 33410 Number of Extensions: 13357021289 Number of Successful Extensions: 585109669 Number of sequences better than 0.0: 0 |