GenBank blast output of UN63882
BLASTX 7.6.2 Query= UN63882 /QuerySize=1008 (1007 letters) Database: GenBank nr; 20,571,509 sequences; 7,061,663,739 total letters Score E Sequences producing significant alignments: (bits) Value gi|296085981|emb|CBI31422.3| unnamed protein product [Vitis vini... 60 5e-007 gi|359486877|ref|XP_002273191.2| PREDICTED: armadillo repeat-con... 60 5e-007 gi|30694137|ref|NP_191047.3| armadillo repeat-containing kinesin... 57 7e-006 gi|5541717|emb|CAB41097.2| kinesin-like protein [Arabidopsis tha... 57 7e-006 gi|193806750|sp|Q9SV36.2|ARK1_ARATH RecName: Full=Armadillo repe... 57 7e-006 gi|297816786|ref|XP_002876276.1| morphogenesis of root hair 2 [A... 57 7e-006 >gi|296085981|emb|CBI31422.3| unnamed protein product [Vitis vinifera] Length = 1331 Score = 60 bits (145), Expect = 5e-007 Identities = 33/58 (56%), Positives = 36/58 (62%) Frame = -3 Query: 453 LNGYNGTIMDYGQTKT*KLIHSESWAKMMKCERGIMVRALEDIFSGAYPAYDSVEISF 280 LNGYNGT+M YGQT T K ERGIMVRALEDI + P DSVEIS+ Sbjct: 103 LNGYNGTVMAYGQTGTGKTYTLGRLGNDDASERGIMVRALEDIIANTSPTSDSVEISY 160 >gi|359486877|ref|XP_002273191.2| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like [Vitis vinifera] Length = 1017 Score = 60 bits (145), Expect = 5e-007 Identities = 33/58 (56%), Positives = 36/58 (62%) Frame = -3 Query: 453 LNGYNGTIMDYGQTKT*KLIHSESWAKMMKCERGIMVRALEDIFSGAYPAYDSVEISF 280 LNGYNGT+M YGQT T K ERGIMVRALEDI + P DSVEIS+ Sbjct: 132 LNGYNGTVMAYGQTGTGKTYTLGRLGNDDASERGIMVRALEDIIANTSPTSDSVEISY 189 >gi|30694137|ref|NP_191047.3| armadillo repeat-containing kinesin-like protein 1 [Arabidopsis thaliana] Length = 941 Score = 57 bits (135), Expect = 7e-006 Identities = 34/58 (58%), Positives = 36/58 (62%) Frame = -3 Query: 453 LNGYNGTIMDYGQTKT*KLIHSESWAKMMKCERGIMVRALEDIFSGAYPAYDSVEISF 280 L+GYNGTIM YGQT T K K ERGIMVRALEDI A A SVEIS+ Sbjct: 178 LSGYNGTIMAYGQTGTGKTYTVGKIGKDDAAERGIMVRALEDILLNASSASISVEISY 235 >gi|5541717|emb|CAB41097.2| kinesin-like protein [Arabidopsis thaliana] Length = 1070 Score = 57 bits (135), Expect = 7e-006 Identities = 34/58 (58%), Positives = 36/58 (62%) Frame = -3 Query: 453 LNGYNGTIMDYGQTKT*KLIHSESWAKMMKCERGIMVRALEDIFSGAYPAYDSVEISF 280 L+GYNGTIM YGQT T K K ERGIMVRALEDI A A SVEIS+ Sbjct: 197 LSGYNGTIMAYGQTGTGKTYTVGKIGKDDAAERGIMVRALEDILLNASSASISVEISY 254 >gi|193806750|sp|Q9SV36.2|ARK1_ARATH RecName: Full=Armadillo repeat-containing kinesin-like protein 1; AltName: Full=Protein MORPHOGENESIS OF ROOT HAIR 2 Length = 1051 Score = 57 bits (135), Expect = 7e-006 Identities = 34/58 (58%), Positives = 36/58 (62%) Frame = -3 Query: 453 LNGYNGTIMDYGQTKT*KLIHSESWAKMMKCERGIMVRALEDIFSGAYPAYDSVEISF 280 L+GYNGTIM YGQT T K K ERGIMVRALEDI A A SVEIS+ Sbjct: 178 LSGYNGTIMAYGQTGTGKTYTVGKIGKDDAAERGIMVRALEDILLNASSASISVEISY 235 >gi|297816786|ref|XP_002876276.1| morphogenesis of root hair 2 [Arabidopsis lyrata subsp. lyrata] Length = 1051 Score = 57 bits (135), Expect = 7e-006 Identities = 34/58 (58%), Positives = 36/58 (62%) Frame = -3 Query: 453 LNGYNGTIMDYGQTKT*KLIHSESWAKMMKCERGIMVRALEDIFSGAYPAYDSVEISF 280 L+GYNGTIM YGQT T K K ERGIMVRALEDI A A SVEIS+ Sbjct: 178 LSGYNGTIMAYGQTGTGKTYTVGKIGKDDAAERGIMVRALEDILLNASSASISVEISY 235 Database: GenBank nr Posted date: Thu Sep 27 19:07:00 2012 Number of letters in database: 7,061,663,739 Number of sequences in database: 20,571,509 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,642,778,995,216 Number of Sequences: 20571509 Number of Extensions: 3642778995216 Number of Successful Extensions: 1030113754 Number of sequences better than 0.0: 0 |