Arabidopsis blast output of UN52164
BLASTX 7.6.2 Query= UN52164 /QuerySize=352 (351 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G54650.1 | Symbols: FBL17 | FBL17; ubiquitin-p... 101 8e-023 >TAIR9_protein||AT3G54650.1 | Symbols: FBL17 | FBL17; ubiquitin-protein ligase | chr3:20226004-20228882 REVERSE Length = 594 Score = 101 bits (251), Expect = 8e-023 Identities = 47/83 (56%), Positives = 62/83 (74%) Frame = -1 Query: 249 ISNSGIGMICNVFPDTLTRLLVTQCPNITSSGIQFATAQLPLLELMDCGMTICEPDAQSP 70 I+++G+GMIC+V PDTL++LLV CPNITSSGIQFATAQLPLLELMDCGMT+ +P++ +P Sbjct: 390 ITDTGLGMICDVLPDTLSKLLVALCPNITSSGIQFATAQLPLLELMDCGMTVSDPNSDNP 449 Query: 69 FCEANGDSDSQVSPNSKLHLIHQ 1 N N K+ + H+ Sbjct: 450 TFVENPSPHKTPGYNQKMFIKHK 472 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,481,082,444 Number of Sequences: 33410 Number of Extensions: 10481082444 Number of Successful Extensions: 442410320 Number of sequences better than 0.0: 0 |