Arabidopsis blast output of UN40442
BLASTX 7.6.2 Query= UN40442 /QuerySize=529 (528 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G53490.1 | Symbols: | DNA binding | chr1:1996... 99 2e-021 >TAIR9_protein||AT1G53490.1 | Symbols: | DNA binding | chr1:19965146-19966811 FORWARD Length = 305 Score = 99 bits (244), Expect = 2e-021 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -1 Query: 261 MRCNACWRELEGRAITTTCGHLLCNEDASKILSNDAACPICDQVLSK 121 MRCNACWR+LEGRAI+TTCGHLLC EDASKILSND ACPICDQVLSK Sbjct: 1 MRCNACWRDLEGRAISTTCGHLLCTEDASKILSNDGACPICDQVLSK 47 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,090,820,138 Number of Sequences: 33410 Number of Extensions: 8090820138 Number of Successful Extensions: 329548763 Number of sequences better than 0.0: 0 |