Arabidopsis blast output of UN38400
BLASTX 7.6.2 Query= UN38400 /QuerySize=489 (488 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G44800.1 | Symbols: CHR4 | CHR4 (CHROMATIN REM... 63 7e-011 >TAIR9_protein||AT5G44800.1 | Symbols: CHR4 | CHR4 (CHROMATIN REMODELING 4); ATP binding / DNA binding / chromatin binding / helicase/ nucleic acid binding / protein binding / zinc ion binding | chr5:18083659-18092162 REVERSE Length = 2243 Score = 63 bits (152), Expect = 7e-011 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = -2 Query: 127 SKCNLKKENASDGSLSKKKGNDGSYYECAVCDLGGDLLCCD 5 SK LK ++ + + SK+KGNDG+Y+EC +CDLGGDLLCCD Sbjct: 51 SKQRLKTDSTPERNSSKRKGNDGNYFECVICDLGGDLLCCD 91 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,403,311,799 Number of Sequences: 33410 Number of Extensions: 2403311799 Number of Successful Extensions: 67101330 Number of sequences better than 0.0: 0 |