Arabidopsis blast output of UN35050
BLASTX 7.6.2 Query= UN35050 /QuerySize=382 (381 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G06780.1 | Symbols: | glycine-rich protein | ... 54 3e-008 >TAIR9_protein||AT3G06780.1 | Symbols: | glycine-rich protein | chr3:2143634-2144239 FORWARD Length = 202 Score = 54 bits (127), Expect = 3e-008 Identities = 24/44 (54%), Positives = 30/44 (68%), Gaps = 1/44 (2%) Frame = -3 Query: 229 WDESE-QKPVDPAFDFVYELLSWFVLSNCLYFAVKRVFRIVVDG 101 WD S DPA +FVYE++ W LSNC++FA KR+ RIV DG Sbjct: 145 WDGSSFSSWSDPAMEFVYEVICWIALSNCVHFAFKRIVRIVTDG 188 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,183,193,157 Number of Sequences: 33410 Number of Extensions: 7183193157 Number of Successful Extensions: 298092191 Number of sequences better than 0.0: 0 |