TrEMBL blast output of UN33295
BLASTX 7.6.2 Query= UN33295 /QuerySize=312 (311 letters) Database: Uniprot/TrEMBL; 23,994,583 sequences; 7,812,677,823 total letters Score E Sequences producing significant alignments: (bits) Value tr|B9T4W3|B9T4W3_RICCO Zinc ion binding protein, putative OS=Ric... 64 1e-008 >tr|B9T4W3|B9T4W3_RICCO Zinc ion binding protein, putative OS=Ricinus communis GN=RCOM_0411700 PE=4 SV=1 Length = 525 Score = 64 bits (153), Expect = 1e-008 Identities = 35/61 (57%), Positives = 41/61 (67%), Gaps = 6/61 (9%) Frame = -1 Query: 275 WLTKIIKGFSSSDKYSRKHHGRYGDG--WECPPTTVDTLSDFDIEEIDRAIALSLLEEDA 102 WLTKI KG S Y ++HGR+G+ WE P + D LSDFD EE+D AIALSL EED Sbjct: 3 WLTKIFKGSS----YKGQYHGRFGEDRYWEEPHRSADDLSDFDREELDCAIALSLSEEDQ 58 Query: 101 K 99 K Sbjct: 59 K 59 Database: Uniprot/TrEMBL Posted date: Thu Sep 27 19:50:57 2012 Number of letters in database: 7,812,677,823 Number of sequences in database: 23,994,583 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,054,821,386,602 Number of Sequences: 23994583 Number of Extensions: 2054821386602 Number of Successful Extensions: 405252660 Number of sequences better than 0.0: 0 |