Arabidopsis blast output of UN30853
BLASTX 7.6.2 Query= UN30853 /QuerySize=285 (284 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G14900.1 | Symbols: | unknown protein | chr3:... 84 1e-017 >TAIR9_protein||AT3G14900.1 | Symbols: | unknown protein | chr3:5013442-5015277 REVERSE Length = 612 Score = 84 bits (206), Expect = 1e-017 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -1 Query: 284 KSKCLEFLLGNHPIELLHPYTKEWKAKLEEMELGCDAPDENEN 156 KS+ L+FLLGNHP ELLHPYTKEWKAKLEEMELGCDAPDE+E+ Sbjct: 376 KSRVLKFLLGNHPNELLHPYTKEWKAKLEEMELGCDAPDEDED 418 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,498,378,151 Number of Sequences: 33410 Number of Extensions: 6498378151 Number of Successful Extensions: 267170825 Number of sequences better than 0.0: 0 |