Arabidopsis blast output of UN23806
BLASTX 7.6.2 Query= UN23806 /QuerySize=466 (465 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G66540.1 | Symbols: | FUNCTIONS IN: molecular... 162 1e-040 >TAIR9_protein||AT5G66540.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: rRNA processing; LOCATED IN: cytosol, nucleolus, nucleus; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 12 growth stages; CONTAINS InterPro DOMAIN/s: U3 small nucleolar ribonucleoprotein complex, subunit Mpp10p (InterPro:IPR012173), Mpp10 protein (InterPro:IPR007151); Has 76240 Blast hits to 38667 proteins in 1479 species: Archae - 252; Bacteria - 6537; Metazoa - 31185; Fungi - 9935; Plants - 3937; Viruses - 750; Other Eukaryotes - 23644 (source: NCBI BLink). | chr5:26556653-26559310 REVERSE Length = 525 Score = 162 bits (409), Expect = 1e-040 Identities = 81/139 (58%), Positives = 104/139 (74%), Gaps = 5/139 (3%) Frame = -2 Query: 404 EDMESDDETK---KGN--LSTHEKQMMEQRAKIEQVEKENLEAKSWTMQGEVTATKRPKN 240 +D+ D+E + KGN LSTHE+ ++ ++KIEQ+EK NL+ K WTMQGE+TA KRP N Sbjct: 261 KDLSEDEEAEIENKGNEKLSTHERARLKLQSKIEQMEKANLDPKHWTMQGEITAAKRPMN 320 Query: 239 SALEADLDWERNANPPPVITEEFSLSIEELIKKRITEGQFDDAERASSLPSKAPREMKEM 60 SALE DLD+E NA P PVITEE + S+E+LIK RI E +FDD +RA LP+K RE KE+ Sbjct: 321 SALEVDLDFEHNARPAPVITEEVTASLEDLIKSRIIEARFDDVQRAPRLPTKGKREAKEL 380 Query: 59 DENQSKKGLGEIYADEYAQ 3 DE++SKKGL E+Y EY Q Sbjct: 381 DESKSKKGLAEVYEAEYFQ 399 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,362,786,392 Number of Sequences: 33410 Number of Extensions: 5362786392 Number of Successful Extensions: 210386093 Number of sequences better than 0.0: 0 |