Arabidopsis blast output of UN22940
BLASTX 7.6.2 Query= UN22940 /QuerySize=298 (297 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G47240.1 | Symbols: NRAMP2, ATNRAMP2 | NRAMP2;... 54 2e-008 TAIR9_protein||AT4G18790.1 | Symbols: NRAMP5, ATNRAMP5 | NRAMP5;... 45 7e-006 >TAIR9_protein||AT1G47240.1 | Symbols: NRAMP2, ATNRAMP2 | NRAMP2; inorganic anion transmembrane transporter/ metal ion transmembrane transporter | chr1:17309043-17311308 REVERSE Length = 531 Score = 54 bits (127), Expect = 2e-008 Identities = 30/67 (44%), Positives = 38/67 (56%), Gaps = 4/67 (5%) Frame = -2 Query: 191 DDHTLLIPQPLSPAKFPVTHQKETAYEANQQITIDDSLDIDHNIT----PPFSLKKLWLF 24 ++ LL P P S + + E A+E N++I I D D T PPFS +KLWLF Sbjct: 12 EEDRLLPPPPPSQSLPSTDSESEAAFETNEKILIVDFESPDDPTTGDTPPPFSWRKLWLF 71 Query: 23 TGPGFLM 3 TGPGFLM Sbjct: 72 TGPGFLM 78 >TAIR9_protein||AT4G18790.1 | Symbols: NRAMP5, ATNRAMP5 | NRAMP5; inorganic anion transmembrane transporter/ metal ion transmembrane transporter | chr4:10317785-10319660 REVERSE Length = 531 Score = 45 bits (105), Expect = 7e-006 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 4/59 (6%) Frame = -2 Query: 179 LLIPQPLSPAKFPVTHQKETAYEANQQITIDDSLDIDHNITPPFSLKKLWLFTGPGFLM 3 LL+P+ P + + + NQ + +++ D ++ PPFS KLW FTGPGFLM Sbjct: 26 LLVPETSQPEE----DELHESPPENQILNVEEDRDKTYDSVPPFSWAKLWKFTGPGFLM 80 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,222,919,389 Number of Sequences: 33410 Number of Extensions: 5222919389 Number of Successful Extensions: 205188853 Number of sequences better than 0.0: 0 |