SwissProt blast output of UN21242
BLASTX 7.6.2 Query= UN21242 /QuerySize=263 (262 letters) Database: Uniprot/SwissProt; 537,505 sequences; 190,795,139 total letters Score E Sequences producing significant alignments: (bits) Value sp|O04716|MSH6_ARATH DNA mismatch repair protein MSH6 OS=Arabido... 68 1e-011 sp|Q54FZ4|Y8927_DICDI Putative uncharacterized protein DDB_G0290... 54 3e-007 sp|Q9FPQ6|GP1_CHLRE Vegetative cell wall protein gp1 OS=Chlamydo... 52 6e-007 sp|P93329|NO20_MEDTR Early nodulin-20 OS=Medicago truncatula GN=... 52 1e-006 sp|O10341|Y091_NPVOP Uncharacterized 29.3 kDa protein OS=Orgyia ... 50 2e-006 sp|Q9E6N3|DEN_GAHVM Deneddylase OS=Gallid herpesvirus 2 (strain ... 50 4e-006 >sp|O04716|MSH6_ARATH DNA mismatch repair protein MSH6 OS=Arabidopsis thaliana GN=MSH6 PE=1 SV=2 Length = 1324 Score = 68 bits (165), Expect = 1e-011 Identities = 42/60 (70%), Positives = 45/60 (75%), Gaps = 6/60 (10%) Frame = -2 Query: 177 KRPSNGRSPLVNPQRQITSFFSKSPSPSPSPSPSP---LSNSK-PKP-NPNPKS-TPSPS 16 +R +GRSPLVN QRQITSFF KS S S SPSPSP LSN K PK NPNPKS +PSPS Sbjct: 5 RRQISGRSPLVNQQRQITSFFGKSASSSSSPSPSPSPSLSNKKTPKSNNPNPKSPSPSPS 64 >sp|Q54FZ4|Y8927_DICDI Putative uncharacterized protein DDB_G0290521 OS=Dictyostelium discoideum GN=DDB_G0290521 PE=4 SV=2 Length = 430 Score = 54 bits (127), Expect = 3e-007 Identities = 25/54 (46%), Positives = 34/54 (62%) Frame = -2 Query: 171 PSNGRSPLVNPQRQITSFFSKSPSPSPSPSPSPLSNSKPKPNPNPKSTPSPSLQ 10 P++ SP +P + S SPSPSPSPSPSP + P P+P+P +PS SL+ Sbjct: 121 PNSSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSSSLE 174 Score = 52 bits (122), Expect = 1e-006 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = -2 Query: 114 SKSPSPSPSPSPSPLSNSKPKPNPNPKSTPSPSLQP 7 S SPSPSPSPSPSP + P P+P+P +PSPS P Sbjct: 124 SPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSP 159 >sp|Q9FPQ6|GP1_CHLRE Vegetative cell wall protein gp1 OS=Chlamydomonas reinhardtii GN=GP1 PE=2 SV=1 Length = 555 Score = 52 bits (124), Expect = 6e-007 Identities = 31/81 (38%), Positives = 41/81 (50%), Gaps = 4/81 (4%) Frame = -2 Query: 261 PPHSSLHKPLFPTPLSLTHCFHTHTMAFKRPSNGRSPLVNPQRQITSFFSKSPSPSPSPS 82 PP S P+ P+P + + A P + P +P S SPSPSPSPS Sbjct: 305 PPSPSPPSPVPPSPAPVPPSPAPPSPAPSPPPSPAPPTPSPSPSP----SPSPSPSPSPS 360 Query: 81 PSPLSNSKPKPNPNPKSTPSP 19 PSP + P P+P+PK +PSP Sbjct: 361 PSPSPSPSPIPSPSPKPSPSP 381 Score = 50 bits (119), Expect = 2e-006 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 5/55 (9%) Frame = -2 Query: 171 PSNGRSPLVNPQRQITSFFSKSPSPSPSPSPSPLSNSKPKPNPNPKSTPSPSLQP 7 PS SP +P + SPSPSPSPSPSP + P P+P+P PSPS +P Sbjct: 328 PSPAPSPPPSPAPP-----TPSPSPSPSPSPSPSPSPSPSPSPSPSPIPSPSPKP 377 >sp|P93329|NO20_MEDTR Early nodulin-20 OS=Medicago truncatula GN=ENOD20 PE=3 SV=1 Length = 268 Score = 52 bits (122), Expect = 1e-006 Identities = 25/47 (53%), Positives = 30/47 (63%) Frame = -2 Query: 141 PQRQITSFFSKSPSPSPSPSPSPLSNSKPKPNPNPKSTPSPSLQPKI 1 P+R + S S SPSPSPSPSPSP S P P+P +S SPS P + Sbjct: 155 PRRSLPSPPSPSPSPSPSPSPSPSPRSTPIPHPRKRSPASPSPSPSL 201 >sp|O10341|Y091_NPVOP Uncharacterized 29.3 kDa protein OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=ORF92 PE=4 SV=1 Length = 279 Score = 50 bits (119), Expect = 2e-006 Identities = 22/55 (40%), Positives = 31/55 (56%) Frame = -2 Query: 171 PSNGRSPLVNPQRQITSFFSKSPSPSPSPSPSPLSNSKPKPNPNPKSTPSPSLQP 7 P+ SP P ++ S +P+PSP+PSP+P P P P+P TPSP+ P Sbjct: 73 PTPALSPTPTPSPTLSPTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPTPSP 127 Score = 50 bits (118), Expect = 3e-006 Identities = 22/55 (40%), Positives = 32/55 (58%) Frame = -2 Query: 171 PSNGRSPLVNPQRQITSFFSKSPSPSPSPSPSPLSNSKPKPNPNPKSTPSPSLQP 7 P+ +P +P T S +PSP+P+PSP+P + P P P+P TPSP+ P Sbjct: 103 PTPSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPTPSPTPSPTPSPTPTPSPTPSP 157 Score = 50 bits (118), Expect = 3e-006 Identities = 29/74 (39%), Positives = 38/74 (51%), Gaps = 3/74 (4%) Frame = -2 Query: 228 PTPLSLTHCFHTHTMAFKRPSNGRSPLVNPQRQITSFFSKSPSPSPSPSPSPLSNSKPKP 49 PTP T T A P+ SP ++P T + SP+PSP+PSP+P + P P Sbjct: 61 PTPTPTPTPSPTPTPALS-PTPTPSPTLSPTPSPTP--TPSPTPSPTPSPTPTPSPTPSP 117 Query: 48 NPNPKSTPSPSLQP 7 P P TPSP+ P Sbjct: 118 TPTPSPTPSPTPTP 131 Score = 50 bits (117), Expect = 4e-006 Identities = 23/55 (41%), Positives = 30/55 (54%) Frame = -2 Query: 171 PSNGRSPLVNPQRQITSFFSKSPSPSPSPSPSPLSNSKPKPNPNPKSTPSPSLQP 7 P+ SP +P T S +PSP+P+PSP+P P P P P TPSP+ P Sbjct: 93 PTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPTPSPTPSPTPSP 147 Score = 49 bits (116), Expect = 5e-006 Identities = 23/55 (41%), Positives = 31/55 (56%) Frame = -2 Query: 171 PSNGRSPLVNPQRQITSFFSKSPSPSPSPSPSPLSNSKPKPNPNPKSTPSPSLQP 7 PS SP P + + SP+P+PSP+PSP + P P+P P TP+PS P Sbjct: 111 PSPTPSPTPTPSPTPSPTPTPSPTPTPSPTPSPTPSPTPTPSPTPSPTPTPSPTP 165 >sp|Q9E6N3|DEN_GAHVM Deneddylase OS=Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) GN=MDV049 PE=3 SV=1 Length = 3342 Score = 50 bits (117), Expect = 4e-006 Identities = 24/56 (42%), Positives = 31/56 (55%) Frame = -2 Query: 171 PSNGRSPLVNPQRQITSFFSKSPSPSPSPSPSPLSNSKPKPNPNPKSTPSPSLQPK 4 P+ SP P+ F +P+P PSP+ P SKPKP P P S PSP+ +PK Sbjct: 2826 PAPKPSPAPKPKPPPDPDFKPTPAPKPSPASKPSPASKPKPPPAPDSKPSPAPKPK 2881 Database: Uniprot/SwissProt Posted date: Thu Sep 27 17:53:50 2012 Number of letters in database: 190,795,139 Number of sequences in database: 537,505 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,064,082,532 Number of Sequences: 537505 Number of Extensions: 21064082532 Number of Successful Extensions: 93696919 Number of sequences better than 0.0: 0 |