Arabidopsis blast output of UN14841
BLASTX 7.6.2 Query= UN14841 /QuerySize=233 (232 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G17370.1 | Symbols: | WD-40 repeat family pro... 46 3e-006 >TAIR9_protein||AT5G17370.1 | Symbols: | WD-40 repeat family protein | chr5:5721801-5724719 REVERSE Length = 468 Score = 46 bits (108), Expect = 3e-006 Identities = 18/30 (60%), Positives = 23/30 (76%) Frame = -2 Query: 180 INIQFNMPQDLPGFYYDAEKNRYFPLKSRI 91 + ++ NM +LPGFYYD EKNRYFP+K I Sbjct: 14 LQVRHNMKPELPGFYYDEEKNRYFPIKGPI 43 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,161,820,803 Number of Sequences: 33410 Number of Extensions: 4161820803 Number of Successful Extensions: 171963989 Number of sequences better than 0.0: 0 |