SwissProt blast output of UN13762
BLASTX 7.6.2 Query= UN13762 /QuerySize=230 (229 letters) Database: Uniprot/SwissProt; 537,505 sequences; 190,795,139 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8S9G8|SPL7_ARATH Squamosa promoter-binding-like protein 7 OS... 49 6e-006 >sp|Q8S9G8|SPL7_ARATH Squamosa promoter-binding-like protein 7 OS=Arabidopsis thaliana GN=SPL7 PE=1 SV=2 Length = 801 Score = 49 bits (116), Expect = 6e-006 Identities = 23/47 (48%), Positives = 32/47 (68%), Gaps = 3/47 (6%) Frame = -2 Query: 141 DQEEEEENKKQKSKMKMTFTSTIMNKCQVPSCEVDISELKGYHKRHR 1 DQ+ E+ +K +++ + + +CQVP CE DISELKGYHKRHR Sbjct: 115 DQKLEDAELPKKKRVR---GGSGVARCQVPDCEADISELKGYHKRHR 158 Database: Uniprot/SwissProt Posted date: Thu Sep 27 17:53:50 2012 Number of letters in database: 190,795,139 Number of sequences in database: 537,505 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,104,125,455 Number of Sequences: 537505 Number of Extensions: 18104125455 Number of Successful Extensions: 77899839 Number of sequences better than 0.0: 0 |