Arabidopsis blast output of UN05015
BLASTX 7.6.2 Query= UN05015 /QuerySize=674 (673 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G23890.1 | Symbols: | LOCATED IN: mitochondri... 55 3e-008 >TAIR9_protein||AT5G23890.1 | Symbols: | LOCATED IN: mitochondrion, chloroplast thylakoid membrane, chloroplast, plastid, chloroplast envelope; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: S-layer homology region (InterPro:IPR001119); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G52410.2); Has 47782 Blast hits to 27307 proteins in 1672 species: Archae - 444; Bacteria - 6951; Metazoa - 22630; Fungi - 3561; Plants - 1682; Viruses - 252; Other Eukaryotes - 12262 (source: NCBI BLink). | chr5:8058789-8063005 FORWARD Length = 947 Score = 55 bits (132), Expect = 3e-008 Identities = 36/118 (30%), Positives = 60/118 (50%), Gaps = 13/118 (11%) Frame = -1 Query: 406 WSDKETEAANEPE-SKNGWSGGVVGAAVAGVVLVGGLAFATLSISRRVSGAKKNMETLTT 230 W D + + K GVVGA VAG++L GL++A S S+R K+ M +LT+ Sbjct: 73 WDDSDNDDKKSSRVKKKSLIEGVVGAGVAGIILFLGLSYAAASFSKRTK--KQEMHSLTS 130 Query: 229 HQEESLTSAD--PNENVKVDETETKNDVLNDNLGVKENENETENENVNEKEYEAATEN 62 QE + S+D ++ +KV +E N +K+ + E+ +V +K E + E+ Sbjct: 131 QQESMIQSSDEISSDEIKVANSEESN--------LKDEDKSIESNDVAQKSDEGSGED 180 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 881,987,589 Number of Sequences: 33410 Number of Extensions: 881987589 Number of Successful Extensions: 27211836 Number of sequences better than 0.0: 0 |